KEGG   Halomicrobium mukohataei: Hmuk_2764Help
Entry
Hmuk_2764         CDS       T00982                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hmu  Halomicrobium mukohataei
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hmu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Hmuk_2764
Enzymes [BR:hmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Hmuk_2764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2655410..2656279
Genome map
AA seq 289 aa AA seqDB search
MARVLCAGHVNWDVTLQVDRLPGPDGEAQIVDQCQSGGGSASNVAVLLAGLDVETTLLGS
VGADEHGWLAARELDRAGVETVLVEADDATAVKYLVVDEGGEVMVLGNDGANEAFTADDL
EPGTLDTTDRLHLTSQRPATAVALARRATEAGCPVSFDPGRRLDERDYEPVLAAVDLVFL
NQREADIAAEAGLLSGVDRVVVKHGAGGAEVRTDGETISHPGFAVDPVDTTGAGDAFAAG
FLAASQSGSDEYALAVGNACGALAARTTGARLHAEWRDVEALLDIGPGE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgtgctctgtgccggccacgtcaactgggacgtaacgctgcaggtcgatcgg
cttccgggcccggacggcgaggcccagatcgtcgaccagtgccagtccggcggcgggagc
gcgtcgaacgtcgcggtcctgctggcgggcctggacgtggagacgacgctgctgggcagc
gtcggtgccgacgaacacggctggctggcggcgcgcgaactcgatcgggcgggcgtcgag
acggtgctggtcgaggccgacgacgcgaccgcggtgaagtacctcgtcgtcgacgagggc
ggcgaggtgatggtgctgggcaacgacggcgcgaacgaggcgttcacggccgacgacctc
gaaccggggaccctcgacacgaccgatcggctccacctgacgagccagcggccggcgacc
gccgtcgcgctcgcccggcgggcgaccgaagcgggctgtccagtgagcttcgatccgggc
cgacggctcgacgagcgcgactacgagcctgtgctcgccgcggtcgatctggtctttctg
aatcagcgcgaggccgacatcgccgccgaggccgggctgctgtccggcgtcgatcgcgtc
gtggtcaagcacggcgcgggcggggccgaggttcggaccgacggcgagacgatcagtcac
cccggattcgccgtcgatccggtcgacacgactggtgccggcgacgcgttcgcggcgggg
tttctcgccgctagccagtccggtagcgacgagtacgcgctggcggtgggcaacgcctgt
ggcgcactggcagcgagaaccaccggggcgcgactccacgcggagtggcgcgacgtcgag
gcgctgctcgacatcgggccgggagagtga

DBGET integrated database retrieval system