KEGG   Halomicrobium mukohataei: Hmuk_2884Help
Entry
Hmuk_2884         CDS       T00982                                 

Definition
(RefSeq) pyridoxal-5'-phosphate-dependent protein subunit beta
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hmu  Halomicrobium mukohataei
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hmu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hmuk_2884
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hmuk_2884
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hmuk_2884
Enzymes [BR:hmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hmuk_2884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2764819..2765937)
Genome map
AA seq 372 aa AA seqDB search
METSPAFREFACADCEETFDADEIELRCPACGGLLVARYDHDLRTEPTRPPLPLARERRH
SLDEGETPATDCPTLADEIGADRLLLKDEGRNPTGAVTDRGLAVAVSAGAAVGADAVSLP
TTGNGGQSAAAYAGRAGVTAHSYVPSRCPFVNKAMINVHGGEMNVVEGRYPDALAAYEDS
DGARFPVGPSSPYRRAGVKRLGYELLTGPAPSAIVVPTGHGIVLAAIHTAIEELRETGAL
DVTPRLYAAQPAGCAPIVDACGTADAVAATEQPDTIVGPLEVPDPAVGSLAVAAVDETGG
RGVAVSDSDALQAAVDAAGTAGVELSATGGVALAGARELAAEFEGETVALVNPVAGSKED
DLLRSHLMSQGI
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggagacgagtccggcctttcgcgagttcgcctgtgcagactgtgaggagacgttcgac
gccgacgagatcgaactgcgctgtccggcgtgtggcggcctcctcgtggcccggtacgat
cacgatctccgtacggaaccgacgcggccgccgctcccgctggcccgcgagcgccgccac
tcgctcgacgagggtgagacgcccgcgaccgactgtccgacactggccgacgagatcggg
gccgatcgactcctgctcaaagacgaagggcgaaatccgaccggcgcggtgacggatcgc
ggactcgcggtcgccgtcagtgccggcgcggcagtcggtgccgacgccgtttcgctcccg
acgaccggcaacggcggtcagtcggcggctgcctacgccggtcgggccggcgtgaccgct
cacagctacgtcccctcgcggtgtccgttcgtcaacaaagcgatgatcaacgtccacggc
ggagagatgaacgtcgtcgagggacgctatcccgacgcgctggcggcctacgaggacagc
gacggggcgcggttccccgtcggcccgtcgtcgccgtaccgtcgcgcgggcgtcaagcga
ctgggctacgagctgctcaccgggccggccccgtcggcgatcgtggtcccgaccggccac
gggatcgtcctcgccgcgatccacacggcgatcgaggaactccgggaaaccggtgccctc
gacgtgacgccgcgtctctacgccgcacagccagcgggctgtgcgcccatcgtcgacgcc
tgcggaaccgccgacgcggtcgcggccaccgaacagcccgacacgatcgtcggccccctg
gaagtccccgatcccgccgtcggctctctcgccgtcgcggccgtcgacgagaccggcggg
cgcggcgtcgccgtctcggacagcgacgcgttgcaggcggccgtcgacgcggccggcact
gccggcgtcgaactcagcgcgaccggcggcgtcgccctggccggcgcgcgcgaactcgcc
gcggagttcgaaggcgagacggtcgcgctggtcaaccccgtcgcaggctcgaaagaggac
gacctgcttcgcagccacctcatgagtcagggcatctag

DBGET integrated database retrieval system