KEGG   Halomicrobium mukohataei: Hmuk_3038Help
Entry
Hmuk_3038         CDS       T00982                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hmu  Halomicrobium mukohataei
Pathway
hmu00260  Glycine, serine and threonine metabolism
hmu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hmu01100  Metabolic pathways
hmu01110  Biosynthesis of secondary metabolites
hmu01130  Biosynthesis of antibiotics
hmu01230  Biosynthesis of amino acids
Module
hmu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hmu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hmuk_3038
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hmuk_3038
Enzymes [BR:hmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hmuk_3038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACV49143
JGI: Hmuk_3038
UniProt: C7P1Q3
Position
complement(2925857..2927152)
Genome map
AA seq 431 aa AA seqDB search
MSSESKFGDYGGQFVPEALMPAIEELTDAYERYVIDNEDGFMDEFRRRLADFGGRPLPLQ
RADQLSARYDTEVYLKREDLLHGGAHKLNNALGQVLLAKYMGKERIIAETGAGQHGTATA
MAAAHLDMPCEIYMGETDIARQRPNVFRMRINDAEVNPVTTGRGTLKEAISETMRDWATT
VETTHYVIGSIVGPAPFPAMVRDFQSVISEEAREQIQEQTGGLPDAVLACAGGGSNTMGA
FHHFVPDDDVDLYAVEAGGSSLSVDEEEGVAPNSASLSTGDEGVLHGARTKLLQDSDGQI
MESHSVSAGLDYAGVGPELAHLVDEGRVTPVNVDDDTALEAFHRLSQDEGIIPALETAHA
FGYLERVAGPATDDRAAEPRDEHHDELGDTVIVNVSGRGDKDLETVIEETQKRDLDIAPD
MSIFNEIGGGI
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgaatccaaattcggcgactacggcggacagttcgtacccgaggcgttgatg
ccggccatcgaggagctgaccgacgcctacgagcggtacgtgatcgacaacgaggacggc
ttcatggacgagttccgtcggcggctggcggacttcggcggccgacccctgcccttacag
cgggccgaccagctctcggcgcgctacgacaccgaggtgtacctcaagcgagaggacctg
ctccacggcggggctcacaagctcaacaacgcgctcgggcaggtcctcctggcgaagtac
atgggcaaggagcgtatcatcgcggagaccggtgccgggcaacacggcacggcgacggcg
atggccgcggcccacctcgacatgccctgcgagatctacatgggcgagaccgacatcgcc
cgccagcggcccaacgtcttccggatgcggatcaacgacgccgaggtgaatccggtgacg
accggccgcgggacgctcaaagaggcgatcagcgagacgatgcgggactgggcgaccacc
gtcgagacgacccactacgtcatcgggtcgatcgtcggcccggctccgttcccggcgatg
gtccgggacttccagtcggtcatcagcgaggaggcccgcgagcagatccaggagcagacc
ggcggcctcccggacgccgtcctggcctgtgcgggtggcggctcgaacacgatgggcgcg
ttccatcacttcgttccggacgacgacgtggacctctacgccgtcgaggccggcggctcc
tcgctgtcggtcgacgaggaggaaggcgtcgcgcccaactcggcgtcgctgtcgaccggc
gacgagggggtactccacggagcgcgcacgaagctccttcaggactctgacggccagatc
atggagtcacactccgtctccgcggggctcgactacgcgggcgtcggtccggaactggcc
cacctcgtcgacgaggggcgcgtgacgccggtcaacgtcgacgacgacaccgcacttgaa
gcgttccaccggctctcccaggacgaggggatcatcccggcgctggagacggcccacgcg
ttcggctatctggagcgcgtggcgggacccgccacggacgatcgagcggcggagccgcga
gatgagcaccacgacgaactgggcgacaccgtgatcgtcaacgtctctggccggggggac
aaggacctcgaaaccgtcatcgaagagacccagaagcgcgatctggacatcgcgccggac
atgtcgatcttcaacgagatcgggggcgggatctag

DBGET integrated database retrieval system