KEGG   Halomicrobium mukohataei: Hmuk_3147Help
Entry
Hmuk_3147         CDS       T00982                                 

Definition
bifunctional folylpolyglutamate synthase/dihydrofolate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hmu  Halomicrobium mukohataei
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hmu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3033296..3035749)
Genome map
AA seq 817 aa AA seqDB search
MKFHEAANFLFDLRRFALRPGTEATRSLLAQLGDPHDSLDCVQIAGSNGKGSTARMVERT
LREAGLDVGLYTSPHLDDVRERIRVNGRKITESAIVEFVESVEPYVTDRAADGTSPTLFE
TLTALAYWEFERQSVDVAVIEVGIGGKLDATSVVDPVASAVTTVTLEHTDILGDTVGEIA
RDKAHVAPADRPLVTATEGDALDAVRDVAGDVVTVADTADGEAGDVSVTDHGREGLEGSV
SIAGDEWGVETKLPLLGAHQAINAGIAATLCRQVSDVDEATIARGLRNAHWPGRFEIMGR
DPLVVLDGAHNPGGVERVVETLAAFDYDELHVVAGSMVDKDLRAIAGALDGADHVVACEP
DRDRAEDEQVVAKAFRDETAASVETRSDVAGAFDVALDGAGEDDCVLVTGSLYAVAEARQ
RWIRPTIPKRVDGVASARETIDAAHVTDAGAWRMRGKAVHRLLKTRVQPRQAQYLKEELL
SLGGDCATSGLNDQDEEMLDVLLMGTMAQFRRLTDKLDGQPYGLASLADELRTALDIQQP
DRDRGYPWDDGTAVMGICNITPDSFHDGGEYDAVEDAVSRAESMVAAGVDVLDVGGESTR
PGADEIPVEEEIERIVPVIERLADLDAAVAVDTRKAPVARAALDAGADILNDVSGLEDPE
MRLVAADYDVPVVVMHSIEVPVDPDSAVDYDDVVEDCIDQLTERVLLAEKAGLDREQIVV
DPGLGFGKSAAESFELLGRLEEFQSLGCPILVGHSHKSMFELVGAEAGDCLDATIAGTTL
AAERGADIVRVHDVPEAVTAVNVVEAADEPGSFVDEG
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgaagttccacgaggcggcgaacttcctcttcgatctccgccgattcgcgctccgaccg
ggcacggaggccactcggtcgctgctggcccagctgggcgacccgcacgactcgctcgac
tgcgtgcagatcgccggctcgaacggcaagggaagcacggctcgcatggtcgaacggacg
ctcagggaggcggggctcgacgtgggcctgtacacctcgccacacctagacgacgttcgg
gaacgcatccgggtcaacggccggaagatcaccgagtcggcgatcgtcgagttcgtcgaa
tcggtcgagccgtacgtcaccgaccgcgcggccgacggcacttcgccgacgctcttcgag
acgctgacggcactggcctactgggagttcgagcgccagtcggtcgacgtggcggtcatc
gaggtcggcatcggtggcaagctcgacgccaccagcgtcgtcgaccccgtcgccagcgcg
gtgacgacggtgacgctcgaacacacggacatcctgggcgacacggtcggcgagatcgcc
cgagacaaggcacacgtcgcgcccgcggaccgcccgctcgtgactgccacagagggcgat
gcgctcgacgccgtccgggacgtggccggcgacgtggtcaccgtcgcagacaccgctgac
ggcgaggccggcgacgtgtcggtcaccgaccacggccgcgagggactggagggatcggtc
tcgatcgcgggcgacgagtggggcgtcgagacgaagctcccgctgctcggtgcccaccag
gcgatcaacgccgggatcgccgcgacgctgtgtcgccaggtttcggatgtcgacgaggcg
acgatcgcacgcggcctgcgaaacgcccactggcccggtcgcttcgagatcatgggacgg
gatcccctggtggtactggacggcgcgcacaaccccggcggcgtcgaacgcgtcgtcgag
acgctggccgcgttcgactacgacgagctccacgtcgtcgcggggtcgatggtcgacaag
gacctgcgtgccatcgcgggcgcactcgacggggccgaccacgtcgtcgcctgcgagccc
gaccgagaccgggccgaagacgagcaggtggtcgcgaaggcgttccgagacgagactgcg
gccagcgtcgagacgcgcagcgacgtggccggcgcgttcgatgtcgccctcgatggggcc
ggcgaggacgactgtgtgctggtcacgggctcgctctacgccgtcgcagaggctcgccag
cgctggatccggccgacgattcccaagcgggtcgacggcgtggcgtcggcacgcgagacg
atcgacgccgcccacgtcaccgacgccggtgcgtggcgcatgcgcggcaaggcggtccac
cgcctcctcaagacgcgggtccagccccgacaggcacagtacctcaaagaagagctgctc
tcgctgggtggggactgtgcgacctcggggctgaacgaccaggacgaggagatgctggac
gtactcctgatggggacgatggcccagttccgccgcctgacggacaagctcgacggccaa
ccgtacggcctcgcgtcgctggccgacgaactccggaccgcgctggacatccagcagccc
gatcgagaccggggctatccctgggacgacggcaccgcagtcatggggatctgtaacatc
acgccggactccttccacgacggcggggagtacgacgccgtcgaggacgccgtttcccgc
gccgagtcgatggtcgcggccggcgtcgacgtcctcgacgtcggcggcgagtccacccgc
cccggcgcggacgagatccccgtcgaggaggagatcgagcgcatcgtcccggtgatcgag
cgcctcgccgacctcgacgccgccgtcgccgtcgacacacgcaaggcaccggtcgcccgc
gccgcgctggacgccggtgcggacatcctcaacgacgtgtccgggctcgaagaccccgag
atgcgcctcgtcgccgcagactacgacgtgcccgtcgtcgtgatgcacagcatcgaggta
ccggtcgatcccgacagcgccgtcgactacgacgacgtggtcgaggactgcatcgaccag
ctgaccgaacgcgtcctgctggccgagaaagcgggcctcgaccgcgaacagatcgtggtc
gatccggggctgggattcggcaaatcggcggccgagagcttcgaactgctgggccgactc
gaagagttccagtcgctgggctgcccgatcctggtcggtcactcccacaagtcgatgttc
gaactcgtcggagccgaggccggggactgcctggacgccaccatcgccgggacgaccctg
gccgccgagcgcggggccgacatcgttcgcgtccacgatgtgcccgaggccgtgaccgcc
gtgaacgtggtcgaagccgccgacgagcctgggtcgttcgtcgacgaaggctaa

DBGET integrated database retrieval system