KEGG   Halomicrobium mukohataei: Hmuk_3174Help
Entry
Hmuk_3174         CDS       T00982                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hmu  Halomicrobium mukohataei
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hmu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Hmuk_3174
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Hmuk_3174
Enzymes [BR:hmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Hmuk_3174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3065499..3067085
Genome map
AA seq 528 aa AA seqDB search
MSLPDVAELDLATKVGQLFVVGFEGPEPTEDLRELLTDYRCGNVIYFSRNIDSPEQVAEL
SRELQTIATEAGPEIPLFVTADQEGGVVSRTDWGTEPPSQMSIGAGRDADLARSVGGAVG
AELASIGVNFDLTPVLDVNNNPDNPVIGVRSFGEEPELVGDLGAAMADGMQSEGVLACGK
HFPGHGDTSADSHHSLPVVDHDRERLDAVELAPFRRAIDAGIDAIMTTHVSFPTITGDDE
LPATVSRDVQTGLLREQLGFDGLVVTDGMEMNAIADEMGTPEGCVQAVEAGCDLLLVCHT
PAVQKDSVEAVIDAVESGRIDESRIDDAVERVLEYKERRGVGQQTPSLDRWEATSDRSRE
VGREVAAAGITVARDRNETIPFDTGRPLHLVGFPGGRASPAEDDRYEPTLVADALEAGGF
DVELHEVETADALPSFEGDEQVVLATYNAAGDDEQVRAVERLDEAVDAFAALVVRNPYDL
ARFPDVSTAVSTYDYTPATLSVTGEILAGRRRASGRLPVTIAGFEAEN
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgccagacgtggccgaactcgatctcgccaccaaagtcggacagctgttcgtc
gtcggcttcgagggaccggagccgacggaggacctccgcgaactcctcaccgactatcgc
tgtggcaacgtcatctacttcagccggaacatcgactcgcccgagcaggtcgccgagctc
agtcgcgagctacagaccatcgccaccgaagcgggacccgagatcccgctgttcgtgacg
gccgaccaggagggcggcgtcgtctcacggaccgactgggggaccgaacccccgagtcag
atgagcatcggtgcgggccgggacgccgacctcgcccgttcggtgggtggcgctgtcggg
gcggaactcgcgtcgatcggcgtcaacttcgatctgacgccggtgctggacgtgaacaac
aacccggacaaccccgtcatcggcgtccggtcgttcggcgaggagcccgaactcgtcggc
gatctcggcgcggcgatggccgacggcatgcagtccgagggcgtgctggcctgtgggaag
cacttcccgggccacggcgacaccagcgccgactcgcaccactcgctacccgtcgtcgac
cacgaccgcgagcgtctcgacgccgtcgaactcgcccccttccgccgggcgatcgacgcc
gggatcgacgcgatcatgacgacacacgtctcgttcccgacgatcaccggcgacgacgaa
ctcccggcgaccgtctcccgagacgtacagaccggactcctccgcgagcagttagggttc
gatggcctggtcgtcaccgacggaatggagatgaacgccatcgccgacgagatggggacg
ccggaagggtgtgtccaggccgtcgaagcgggctgtgatctcctcctggtctgtcacacc
cccgcggtccagaaagactcggtcgaggcggtcatcgacgccgtcgagtccggccgcatc
gacgagtcgcggatcgacgacgctgtcgagcgcgtcctcgagtacaaggagcgacgcggc
gtcggccagcagacgccctcgctcgaccgctgggaggcgaccagcgatcgctcccgcgag
gtcggtcgtgaggtcgccgcggccggcatcacggtcgctcgggatcgaaacgagacgatt
cccttcgacaccggacgaccgcttcacctcgtcggcttccccggcggacgcgcttcgccg
gcagaggacgaccgctacgagccgacgctggtcgccgacgcactcgaagccggcggcttc
gacgtggaactgcacgaggtggagaccgccgacgccctgccgtcgttcgagggcgacgaa
caggtcgtgctggcgacctacaacgccgctggcgacgacgaacaggtgcgagcggtcgag
cgactggacgaggccgtcgacgccttcgccgcgctggtggtgcgcaacccctacgacctc
gctcgcttccccgacgtgtcgacggcggtgtcgacctacgactacacgcccgcgacgctg
tcggtgaccggcgagatcctggccggccggcgtcgggccagcggtcggctgccggtgacg
atcgcgggcttcgaggccgagaactga

DBGET integrated database retrieval system