KEGG   Halomicrobium mukohataei: Hmuk_3226Help
Entry
Hmuk_3226         CDS       T00982                                 

Definition
glycoside hydrolase family 2 TIM barrel
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
hmu  Halomicrobium mukohataei
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:hmu00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:hmu00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pHmuk01:complement(4681..7782)
Genome map
AA seq 1033 aa AA seqDB search
MPDWTDPRVVGRNRLAPHTDVFPFSDEQSARRDSVTASPWVRRLNGEWQFHLAETPADAP
AIPGATDDVDWDRIEVPLNWQLDGHGHPHYTNVVYPFPVDPPHVPTENPTGTYRRSVHVD
EDWDGRQIRLRFEGVDSAFHLWVNGERVGYSEGARLPAEFDVSDYVEPGENTVTARVYKW
SNGSYLEDQDMWWLSGIFRDVTLYAVPETHVADVDVRTELDDDYVDARFSAAVDIESVAG
GDATGRLRASLVDEAGDTAATFAESYALTDGETTLSLSTTVEDPDKWTAETPDRYTLLVT
LLDDGTPVETVRETVGFREVEIDGGQFLVNGEAVTIRGVNRHDFDPDRGRAVTVDQMRAD
IELMKRHNVNAVRTAHYPNDTRFYDLCDEYGLYVMDETDIECHGMERIDAVQHLSDDPAW
EDTYVDRMVRMLERDKNHPSVVIWSLGNESAVGAHHETMYELTRERDPTRPVHYEQDHDQ
RVSDIVGPMYTPPEDIEALAVDDPDHPVILCEYAHAMGNGPGGFEEYWDVFDGHERLQGG
FVWDWIDQGIRQTTEDGAEWFAYGGDFGDEPNTGNFNINGLVFPDRTPSPGLTEFKNVVE
PVTFEPAALERGELVVENRYDFRGLDHLRARWRVEADGRVVQSGTLDLPAVAPGDSEPVT
VPFEDAGRGERFLVVEVSLASDTSWAPAGHTVATSQHELPTSEAPTVPAATLPAPLSCER
SDDEIVVSNAEFELRFDARYGVVDSLSYRGRSVVTEGPEVGLWRAPTDNDRGLPLVPTFF
TRFLELHENEEPIADWDARTVGFAQIWREHGLDSLQSRVDAVDTEVGEETVTITVDGRLA
PPMFAHGFATTQTYTIHPTGAVEIETDLDPEGDLSMLPSLPRIGLDLTLDGDFDHVTWYG
RGPGESYADSEQASPVGRYEADVADLHTPYVRPQANGTRSDTRWVAVTDRNGTGLLATGD
SLLDVTAHHYSTEQLEAADHEHELSREDDVFLSLDHAHSGLGSGSCGPETFESDRVQPER
TSFTVTLHPYVDD
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
atgcccgactggacagatccgcgagtagtcggtcgtaacaggctcgcaccacacactgac
gtgttcccgttctcggacgagcaatctgcacgccgggacagcgtgactgcctcgccgtgg
gttcggcgattgaacggcgagtggcagtttcacctcgccgagacccctgcggacgcgcca
gcgatcccgggcgcgacggacgacgtcgactgggaccgaatcgaggtcccgctgaactgg
caactcgacggccacggacacccacactacacgaacgtcgtctacccgttcccggtcgat
ccgccccacgttccgaccgagaacccgacggggacgtaccggcgctccgtccacgtcgac
gaggactgggacggtcgacagatccgcctgcgcttcgagggggtcgactccgccttccac
ctctgggtcaacggcgagcgcgtcggctacagcgaaggcgcgcgtctccccgcggagttc
gacgtgagcgactacgtcgagccgggggagaacacggtcactgcacgggtctacaagtgg
tctaacgggagctacctcgaagatcaggacatgtggtggctcagcggcatcttccgtgac
gtcaccctgtacgccgtgccggagactcacgtcgcggacgtcgacgtccgtaccgaactg
gacgacgactacgtcgacgcccggttctccgcggcggtcgacatcgaatcggtagccggt
ggcgacgcgacgggccgtctccgcgcctctctggtcgacgaagcgggcgacactgccgcc
accttcgcggagtcgtacgcgctgaccgacggtgagacgacgctctcgctgtcgacgacc
gtcgaggacccggacaagtggaccgcagagacgccggaccggtacacgctcctggtgacg
ctactggacgacggaacgcccgtcgagaccgttcgcgagacggtcggctttcgcgaggtc
gagatcgacggcggccagttcctggtcaacggcgaagccgtgacgatccgcggcgtgaac
cgccacgacttcgatcccgaccgggggcgggccgtcaccgtcgaccagatgcgcgcggac
atcgagctgatgaaacggcacaacgtcaacgccgtccggaccgctcactaccccaacgac
acgcggttctacgacctctgtgacgagtacgggctctacgtcatggacgagaccgacatc
gagtgtcacgggatggaacgcatcgacgccgtccagcatctcagtgacgaccccgcgtgg
gaagacacctacgtcgatcggatggtccggatgctcgaacgagacaagaaccacccgagc
gtcgtgatctggtcgctgggcaacgagtccgcagtcggggcccaccacgagacgatgtac
gagctgacacgcgagcgcgatccgacgcggccggtccactacgagcaggaccacgaccag
cgggtcagcgacatcgtcgggcccatgtacaccccgcccgaggacatcgaggccctggca
gtcgacgatccggaccaccccgtgatcctctgtgagtacgcccacgccatggggaacggt
ccgggcgggttcgaggagtactgggacgtattcgacggccacgagcgactgcagggcggg
ttcgtctgggactggatcgaccagggcatccgccagacgaccgaggacggagcggagtgg
ttcgcctacggcggcgacttcggcgacgagcccaacacggggaacttcaacatcaacggt
ctcgtctttcccgatcgaacgccctcgccgggcctcaccgagttcaagaacgtcgtcgag
ccggtcacgttcgagcccgcagccctcgaacggggcgaactcgtcgtcgagaaccgctac
gacttccgcgggctagatcacctccgcgcccggtggcgcgtcgaggccgacggccgggtc
gtccagagtggcacgctcgacctcccagccgtcgcacccggcgacagcgaacccgtcacg
gtgccgttcgaggatgctggccggggcgagcggttcctcgtcgtcgaggtctcgctggcc
agtgacacgtcgtgggcaccggccggccacacggtcgcaacgagccagcacgaactcccg
acgagcgaggcaccgacggtgccggccgcgacgcttcccgcaccgctgtcctgtgaacgc
agcgacgacgagatcgtcgtctcgaacgcggagttcgagctccggttcgacgcccgatac
ggcgtcgtcgactcgctgtcctaccgcggtcggtcggtcgtcaccgagggtcccgaggtc
ggactctggcgtgccccgacggacaacgacagagggttgccgctggtcccgactttcttc
acgcgcttcctcgaactacacgaaaacgaggaaccgatcgccgactgggacgcccggacg
gtcggcttcgcacagatctggcgcgagcacggtctcgacagcttgcagtcccgcgtcgac
gccgtcgacaccgaggtcggggaggagacggtcacgatcaccgtcgacggtcgcctcgcg
ccgccgatgttcgcccacgggttcgcgacgacgcagacgtacacgatccaccccaccgga
gccgtcgagatcgagacggatctcgaccctgagggcgacctctcgatgctcccgtcgctg
ccacggatcggactcgacctgacgctcgacggggacttcgaccacgtcacgtggtacggc
cgcggcccgggcgagtcctacgccgacagcgagcaggcgtcccccgtcggtcggtacgag
gccgacgttgccgacctccacacgccctacgtcaggccccaggcgaacggcactcgcagc
gacacccgctgggtggccgttaccgaccgcaacggtaccgggctcctcgcgaccggggac
tcgctgctcgacgtgaccgcacaccactactcgaccgagcagctggaggccgccgatcac
gaacacgaactgtcccgcgaggacgacgtgttcctctcgctggaccacgcacactccgga
ctcgggtcgggcagctgtgggcccgagacgttcgagtccgaccgcgtccagcccgagcgg
acctcgttcacggtcacgctccacccgtacgtcgacgactga

DBGET integrated database retrieval system