KEGG   Halomicrobium mukohataei: Hmuk_3393Help
Entry
Hmuk_3393         CDS       T00982                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
hmu  Halomicrobium mukohataei
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:hmu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hmuk_3393
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Hmuk_3393
Enzymes [BR:hmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Hmuk_3393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pHmuk01:196148..196996
Genome map
AA seq 282 aa AA seqDB search
MSEQSAIESVGEATVEQAREQAADAQRVIVKAGTNSLTDEDSQLDRVKLDKLVSDIMDLR
KRGKDVLLVSSGAVGAGKGLIDEETETVEESQALSTVGQSHLMRHYTQSFDRYDQTVAQI
LLTEHDLANPERFTNVRNTIETLFDWGIVPIINENDAIATEEIQIGDNDMLSASVAIGVN
ADLLVTLTDVGGVYTGNPKDDDDAALIEAVGANYDAVQSLVDDSTTAEFGGIQTKVEGAR
DVSEHGTPAIIAGSADRDVLERIATAKSVGTLFVPINGATDD
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcagtcggcgatcgagagcgtcggcgaggcgaccgtcgagcaggcgcgcgag
caggccgccgacgcccagcgcgtgatcgtcaaggcggggacgaactcgctgaccgacgag
gactcccagctcgatcgcgtgaaactcgacaagcttgtcagcgacatcatggacctccgg
aagcgggggaaggacgtgctgctggtctcgtctggcgcggtcggtgcgggcaaggggctg
atcgacgaggagaccgagaccgtcgaggagagccaggccctctcgacggtcggacagagc
cacctgatgcgccactacacccagagcttcgaccgctacgaccagacggtcgcacagatc
ctgctgaccgagcacgatctggccaaccccgagcgctttacgaacgtccgcaacaccatc
gagacgctgttcgactgggggatcgtgccgatcatcaacgagaacgacgcgatcgcgacc
gaggagatccagatcggcgacaacgacatgctctcggcgtcggtcgccatcggcgtcaac
gccgacctgctggtgaccctgaccgacgttggcggcgtctacacgggcaacccgaaagac
gacgacgacgcggcgctgatcgaggcagtcggcgcgaactacgacgccgtccagtcgctc
gtcgacgacagcacgaccgccgagttcggcggcatccagacgaaagtcgagggcgcgcgc
gacgtgagcgaacacggcacaccggcgatcatcgccggctcggcggaccgcgacgtactg
gaacggatcgctactgccaaatcggtgggcacgctattcgtcccgataaacggagccaca
gatgactga

  All links  
No link information was found.   
DBGET integrated database retrieval system