KEGG   Halomicrobium mukohataei: Hmuk_3393Help
Entry
Hmuk_3393         CDS       T00982                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
hmu  Halomicrobium mukohataei
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hmu01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hmu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pHmuk01:196148..196996
Genome map
AA seq 282 aa AA seqDB search
MSEQSAIESVGEATVEQAREQAADAQRVIVKAGTNSLTDEDSQLDRVKLDKLVSDIMDLR
KRGKDVLLVSSGAVGAGKGLIDEETETVEESQALSTVGQSHLMRHYTQSFDRYDQTVAQI
LLTEHDLANPERFTNVRNTIETLFDWGIVPIINENDAIATEEIQIGDNDMLSASVAIGVN
ADLLVTLTDVGGVYTGNPKDDDDAALIEAVGANYDAVQSLVDDSTTAEFGGIQTKVEGAR
DVSEHGTPAIIAGSADRDVLERIATAKSVGTLFVPINGATDD
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcagtcggcgatcgagagcgtcggcgaggcgaccgtcgagcaggcgcgcgag
caggccgccgacgcccagcgcgtgatcgtcaaggcggggacgaactcgctgaccgacgag
gactcccagctcgatcgcgtgaaactcgacaagcttgtcagcgacatcatggacctccgg
aagcgggggaaggacgtgctgctggtctcgtctggcgcggtcggtgcgggcaaggggctg
atcgacgaggagaccgagaccgtcgaggagagccaggccctctcgacggtcggacagagc
cacctgatgcgccactacacccagagcttcgaccgctacgaccagacggtcgcacagatc
ctgctgaccgagcacgatctggccaaccccgagcgctttacgaacgtccgcaacaccatc
gagacgctgttcgactgggggatcgtgccgatcatcaacgagaacgacgcgatcgcgacc
gaggagatccagatcggcgacaacgacatgctctcggcgtcggtcgccatcggcgtcaac
gccgacctgctggtgaccctgaccgacgttggcggcgtctacacgggcaacccgaaagac
gacgacgacgcggcgctgatcgaggcagtcggcgcgaactacgacgccgtccagtcgctc
gtcgacgacagcacgaccgccgagttcggcggcatccagacgaaagtcgagggcgcgcgc
gacgtgagcgaacacggcacaccggcgatcatcgccggctcggcggaccgcgacgtactg
gaacggatcgctactgccaaatcggtgggcacgctattcgtcccgataaacggagccaca
gatgactga

DBGET integrated database retrieval system