KEGG   Halothiobacillus neapolitanus: Hneap_0035Help
Entry
Hneap_0035        CDS       T01104                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
hna  Halothiobacillus neapolitanus
Pathway
hna00230  Purine metabolism
hna01100  Metabolic pathways
Module
hna_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Hneap_0035
Enzymes [BR:hna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Hneap_0035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_30 AAA_16 AAA_23 ABC_tran AAA_22 MobB RsgA_GTPase CPT EzrA Thymidylate_kin AAA_35
Motif
Other DBs
NCBI-ProteinID: ACX94901
JGI: Hneap_0035
UniProt: D0KVX4
Position
complement(42146..42775)
Genome map
AA seq 209 aa AA seqDB search
MSQGQLFVISAPSGAGKTSLIKALREQMPDLGLSISHTTRPMRPGEVDGQHYHFVSKPTF
ESMIAEGAFVEHALVFGNHYGTSKAAVSAVLDKGQDLILEIDWQGAEQVRPLFSGAQSIF
ILPPSREALRERLFGRGQDDADVIARRLAEAEREMQAYPNYDFLIINDDFSQALNQLRCL
FESARLRTPRQAEKERVRLENLLNTPKKT
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaggtcagttatttgtcatttccgccccatccggcgcgggaaaaaccagtctc
atcaaggccctgcgtgagcagatgcccgatctcggcctgtcgatatcgcacaccacgcgc
cccatgcgccccggtgaagtggatggccagcactaccacttcgtcagtaagccgacattc
gagtcgatgattgccgaaggcgctttcgtggaacatgcgctggttttcggcaaccactac
gggacatccaaggccgccgtcagcgccgtgctcgacaaaggtcaggatctgatcctagaa
atcgactggcaaggcgccgaacaggtacgcccacttttttcgggggcgcagagcatcttc
attctccctccgagccgtgaagcgcttcgggaacgcctcttcggacgcgggcaagatgat
gccgatgtcatcgcccggcggctggccgaggccgagcgggaaatgcaggcttacccgaac
tacgacttcctcatcatcaacgatgatttttcacaggcgctcaatcagttacgctgcctg
ttcgagagcgcacgcctgcgcacaccgcgtcaggccgaaaaggaacgtgttcgcttggaa
aatttgctgaacacccctaaaaaaacgtaa

DBGET integrated database retrieval system