KEGG   Halothiobacillus neapolitanus: Hneap_0035Help
Entry
Hneap_0035        CDS       T01104                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
hna  Halothiobacillus neapolitanus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hna00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(42146..42775)
Genome map
AA seq 209 aa AA seqDB search
MSQGQLFVISAPSGAGKTSLIKALREQMPDLGLSISHTTRPMRPGEVDGQHYHFVSKPTF
ESMIAEGAFVEHALVFGNHYGTSKAAVSAVLDKGQDLILEIDWQGAEQVRPLFSGAQSIF
ILPPSREALRERLFGRGQDDADVIARRLAEAEREMQAYPNYDFLIINDDFSQALNQLRCL
FESARLRTPRQAEKERVRLENLLNTPKKT
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaggtcagttatttgtcatttccgccccatccggcgcgggaaaaaccagtctc
atcaaggccctgcgtgagcagatgcccgatctcggcctgtcgatatcgcacaccacgcgc
cccatgcgccccggtgaagtggatggccagcactaccacttcgtcagtaagccgacattc
gagtcgatgattgccgaaggcgctttcgtggaacatgcgctggttttcggcaaccactac
gggacatccaaggccgccgtcagcgccgtgctcgacaaaggtcaggatctgatcctagaa
atcgactggcaaggcgccgaacaggtacgcccacttttttcgggggcgcagagcatcttc
attctccctccgagccgtgaagcgcttcgggaacgcctcttcggacgcgggcaagatgat
gccgatgtcatcgcccggcggctggccgaggccgagcgggaaatgcaggcttacccgaac
tacgacttcctcatcatcaacgatgatttttcacaggcgctcaatcagttacgctgcctg
ttcgagagcgcacgcctgcgcacaccgcgtcaggccgaaaaggaacgtgttcgcttggaa
aatttgctgaacacccctaaaaaaacgtaa

DBGET integrated database retrieval system