KEGG   Halothiobacillus neapolitanus: Hneap_0042Help
Entry
Hneap_0042        CDS       T01104                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
hna  Halothiobacillus neapolitanus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hna00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:hna00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:hna02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
48154..50388
Genome map
AA seq 744 aa AA seqDB search
MNATSPSLALAHSNSRRQFLKLIVLTASAGALAACGGGDGGAENISTDTRYFPQSVASGD
PAANSVILWTRLGTLGPQTDGQLRVQVSTQEDFSNLIVDESAVPVAAAHDHCLRLKVAGL
KPGTTYYYRFLFSTGNQAWASSRTGRTKTAPDATANVPVSYAVTSCQDYIGRYYNVWAYL
LQTEPDLDFILQIGDYIYETTGDPSFQTVGSARSITFTDTAGAIQLGDATAPYYAASSVS
NYRDLYKAYRSDPILQQVHERYPMIGIWDDHEYSDDCWGATATYFNGREDEYNPPRRDRA
EQVYYEFMPLDDPAIASGALNKDPATLWPNNVLYRRLRFGQNLEAVLLDYRSYRPDHLIP
EGGFPGKVVMSEPVLVSILGQTAYDAVKANFGPYVDTTTAPWNSYLTALIPVLAQGYLQA
GFTGDAQTKATDDLTGLVSAFVFNQLIGQFNAAVAAGQIPGASALPAIDSTTYDALPRGI
AFLHIGKQSFFSELGARYAVVQPTFDLYAQYMQATGQYEQDPLGATQRQFLANALASDAT
FINVISTVSTAPLRWDLRSATNLPADYQTVFKPNVDQWDGFPQGKQAFLETLANRPGAFL
ASGDIHASFVTQHQTSSMAMPVADFTGPAISSGTFNNFVESAISGLPGLDSAQKAAANQA
LVLGLDQTLQASAPADEPIVFADTTHHGIMVFRVDGSQTQVDYLLIDQSAVSQNLTGDSS
ALIKAFSRQRFTLDPQTGKVTSAS
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaacctcgccatcactcgctctggctcattccaatagtcgtcgtcagtttctc
aagctgattgtactgacagcctcggcaggcgcgttggcggcttgtggcggcggggacggt
ggggcagaaaacatctcgacggacacccgctatttcccgcaatcagtagcatcgggcgat
ccagccgcaaactcggtcattctctggacccgtttgggtacgctcggtccgcaaaccgat
gggcaattgcgtgttcaagtcagcacgcaagaggatttttccaatctgatcgtcgatgaa
tccgccgtgcccgtggccgccgcgcacgatcattgtctgcgcttgaaagtggccggtctt
aagcccggaacgacgtattactatcgttttctgttctccaccggcaaccaggcctgggcc
agctcgcgcactgggcgaaccaaaaccgcgcccgacgccaccgcgaacgtgcccgtcagt
tacgccgtcacttcctgtcaggattacattggtcgttattacaacgtgtgggcttattta
ctgcaaaccgagccggatctggattttattctgcaaatcggcgattacatctacgagacc
acgggcgacccctcgtttcaaacggtgggcagtgcgcgcagcatcacctttaccgatacg
gcaggcgccattcaattaggcgatgcgaccgcgccttattacgcggcctccagcgtgtcg
aattaccgcgatctgtataaggcgtatcgcagcgacccgatcttgcagcaagtgcatgag
cgttacccaatgatcggcatctgggacgaccacgaatactccgacgattgctggggtgcg
accgccacctatttcaatggccgcgaagatgaatacaacccgcctcggcgtgaccgcgcc
gaacaggtgtattacgagtttatgccgttggatgaccccgctatcgccagcggcgcgctc
aacaaagatccggctacgctttggccgaataacgtgctgtatcgccgcctgcgctttggc
cagaacttagaagccgtgctgctcgattaccgcagctatcgccccgatcacctcatcccc
gaaggcggctttcccggcaaggtggtgatgagcgagccggtgctggtgagcatcttgggg
caaaccgcttacgatgctgttaaagcaaactttggcccctatgtcgataccaccaccgcg
ccttggaacagctatctgacggccttgattccggtgttggcgcaaggataccttcaggct
gggttcacaggcgatgcgcaaaccaaggccaccgacgatctcaccggccttgtttccgcc
tttgtattcaatcagctcattggccaattcaatgccgccgtagcagcaggacaaattccg
ggggcgagtgccctgccagccatcgattcgactacctacgatgccttgccgcgcggtatc
gccttcctgcacatcggcaagcagtcgttcttctctgagctcggcgcgcgctatgccgtg
gtgcagccgacctttgatttgtatgcccaatacatgcaggccaccgggcaatacgaacaa
gacccgctgggcgcaacacaacgccagtttttggcgaatgccctggcatccgatgccacc
tttatcaacgtgatcagcaccgtctcaaccgcgcccttgcgctgggatttgcgctcggcc
accaacttgcctgccgattaccaaacggtgttcaagcccaatgtggatcagtgggatgga
tttccgcaaggcaagcaggctttcttggaaaccttggcgaatcgaccgggcgcgtttttg
gcctccggcgatattcacgccagcttcgtcacgcaacatcaaaccagctctatggcaatg
ccggtggcggattttaccggcccggccatcagctcgggtacgtttaacaatttcgtggaa
tcggccatttccggcttgcctgggctggattcagcgcaaaaagcggcggctaatcaagcc
ttggtgctggggctcgatcaaaccctgcaagcctctgcgcctgccgatgagccgattgta
tttgcagatacaacccaccacgggattatggtcttccgcgtggatggttcacaaacgcaa
gtcgattatctgctgatcgatcaaagcgccgtcagccagaatttaacgggcgattcgtcc
gccttgatcaaggcgttcagccgccaacgttttacgcttgatccgcaaacgggcaaggtg
acaagcgcaagctga

DBGET integrated database retrieval system