KEGG   Halothiobacillus neapolitanus: Hneap_0489Help
Entry
Hneap_0489        CDS       T01104                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hna  Halothiobacillus neapolitanus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hneap_0489
   00030 Pentose phosphate pathway
    Hneap_0489
   00051 Fructose and mannose metabolism
    Hneap_0489
   00052 Galactose metabolism
    Hneap_0489
   00500 Starch and sucrose metabolism
    Hneap_0489
   00520 Amino sugar and nucleotide sugar metabolism
    Hneap_0489
  Nucleotide metabolism
   00230 Purine metabolism
    Hneap_0489
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hneap_0489
Enzymes [BR:hna01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Hneap_0489
    5.4.2.8  phosphomannomutase
     Hneap_0489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
518883..520364
Genome map
AA seq 493 aa AA seqDB search
MDLTCFKAYDIRGQVPAQLDAELAYRIGRAFVDEINPGTVVVGYDVRLESPMLAEALMRG
ITEAGADVIDIGLCGTEEVYFQTFHREAQGVGGGIMVTASHNPKGYNGMKLVREGARPVS
GDTGLFAIRDSIANPPSSLAGEGGLRQLRVGGDEWRHDARADSTPSPLVGEGWGEGENTP
KPHGKITTDTNKAAYIQHLLGYIDHRALKPLKIVADPGNGGAGPVMRLLEKHLPFDIHYI
HEQPDGNFPNGVPNPLLPEMRDATSQAVIEQGADLGIAWDGDFDRCFLFDAKGRFIEGYY
LVGLLAETLLAKHPGGKIIHDPRLTWNTIEQVEQAGGIPIQSKTGHAFIKQIMREQDAIY
GGEMSAHHYFRDFGYCDSGMIPWLLITELMSKTGKTLAELVDERMAAYPCSGEINYRIDD
VQGTIDRVLAHFSPMNPKIDRTDGVSVEFDDWRFNLRGSNTEPLLRLNVETRSDSLLLER
QISVVENLIGKDF
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggacttgacttgcttcaaagcctacgacattcgcggccaagtgcccgcgcaactcgat
gccgaactcgcctaccgtatcgggcgcgcgtttgttgatgaaatcaatcccggcaccgtc
gtggtcggatacgatgtgcgcctcgaaagccccatgctggccgaagccttgatgcgcggc
atcaccgaggcgggcgctgatgtcatcgacatcggcctgtgcggcaccgaagaagtctat
ttccagacctttcaccgcgaagcgcaaggcgtaggcggcggcatcatggttaccgccagc
cacaatcccaagggctacaacggcatgaagctcgtgcgcgaaggcgcgcgccccgttagt
ggcgacaccggcctgttcgccatccgcgacagcatcgcaaatcccccctcttccctcgcg
ggagagggggggcttcgccagcttcgcgttgggggtgatgagtggcgtcatgatgctcgt
gcggattcaaccccctctcccctagtgggagagggatggggtgagggggaaaacacacca
aagccacacggcaaaatcaccaccgacaccaataaagccgcctacatccaacatctgctc
ggctacatagaccaccgcgccctcaaaccgctcaaaatcgtggccgaccccggcaatggc
ggtgccggcccagtcatgaggctgttggaaaagcatctgccgttcgatattcactacatt
cacgaacagccggacggcaacttcccaaacggcgtccccaacccgctcttgcccgaaatg
cgcgacgcgacctcacaggctgttatcgaacaaggcgctgatctcggtatcgcttgggat
ggcgactttgatcgttgctttttgtttgatgccaaaggccgtttcatcgaaggttattat
ctggttggcttgctggccgaaaccctgcttgccaagcatcccggtggaaaaatcattcac
gacccgcgcctgacttggaacaccatcgagcaagtagaacaggcgggcggcatccccatc
cagtccaaaaccggccacgccttcatcaagcagatcatgcgcgagcaagatgccatttac
ggcggcgagatgagcgcgcatcactacttccgtgatttcggctactgcgattcaggcatg
atcccatggctacttatcaccgagctcatgagcaaaaccggcaaaacgctcgccgaatta
gtggatgaacgcatggcggcttacccctgcagcggtgaaatcaattatcgcatcgacgat
gtacagggcaccattgaccgcgtattggctcacttctcccccatgaaccccaaaattgat
cgtacagatggcgttagcgtggagttcgacgattggcgatttaacttaagaggttcaaat
accgagccgctgctgcgactgaatgttgagactcgtagtgattccttgcttttggaaagg
cagatttcagtagtcgaaaatttaattgggaaggatttttaa

DBGET integrated database retrieval system