KEGG   Halothiobacillus neapolitanus: Hneap_0547Help
Entry
Hneap_0547        CDS       T01104                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hna  Halothiobacillus neapolitanus
Brite
Enzymes [BR:hna01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Hneap_0547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
583493..584272
Genome map
AA seq 259 aa AA seqDB search
MTSSDFPRLKKILSSSDKPELRVPEKTLKKTARRVEDELPSFSKQGPDYTWARGAMVERL
RQQGVSNAKVLAAMNTLAREAFVDEALRMRVYDDCSLPIGQGQTLSQPYIVGRMSELLLG
ASIPVKRVLEIGTGSGYQAAVLAQCGCAVFTIERIGTFLEVAKARHRRLGLLNIRYLHRD
GFKGWPSQAPFDGIIVTAAPSNIPDELKAQLVDGGRLIVPVGSQGEAQRLTVITRTENDF
RSQFFDAVSFVPMLPGEQS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgacatcatccgattttccacgtctgaagaagatactgtcttcctcagacaagccagaa
ttgcgtgtgcccgagaagacgctaaagaaaacagcgcgtcgtgttgaagacgagcttccc
tctttttccaagcaaggcccagactacacttgggcacgcggagccatggttgaacgattg
cggcagcagggtgtatccaacgcgaaggtgttggcggcgatgaatacgctggcacgcgag
gcatttgtcgatgaggccctgcgtatgcgggtatatgacgattgctcattgcccatcggg
cagggacagacactatctcagccttatatcgtggggcggatgtccgagttgcttctgggg
gcgagtatcccagtgaaacgggtgctggagatcggcaccggttcggggtatcaggccgcc
gtgcttgctcaatgtggttgtgcggtgtttacgatcgaaaggatcgggacctttctggag
gtcgccaaggctcggcatcgtcgtctggggctactgaacattcgttatttgcatcgggat
ggtttcaaggggtggccttcgcaagccccatttgatgggatcatcgtgacggccgcgcca
tcgaacatacccgatgagctcaaagcacaactggtcgatggcgggcggcttattgtaccc
gttggctcgcaaggtgaggctcagagactcaccgtgattacccgtaccgaaaatgacttt
agaagtcagttttttgatgcggtcagttttgtccccatgcttcctggagaacagtcttga

DBGET integrated database retrieval system