KEGG   Halothiobacillus neapolitanus: Hneap_0592Help
Entry
Hneap_0592        CDS       T01104                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
hna  Halothiobacillus neapolitanus
Pathway
hna00860  Porphyrin and chlorophyll metabolism
hna01100  Metabolic pathways
hna01110  Biosynthesis of secondary metabolites
Module
hna_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hneap_0592
Enzymes [BR:hna01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Hneap_0592
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Hneap_0592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO HI0933_like Pyr_redox_3 Pyr_redox_2 FAD_binding_2 FAD_oxidored Pyr_redox FAD_binding_3 AlaDh_PNT_C GIDA MCRA Thi4
Motif
Other DBs
NCBI-ProteinID: ACX95445
JGI: Hneap_0592
UniProt: D0KYC2
Position
complement(635192..636610)
Genome map
AA seq 472 aa AA seqDB search
MNTHSNASEPINCPYLVIGGGISGLATAYHLSRMGKTVTVLEATSRVGGAVGSIEEDGWL
RELGPNSLVQTPEMAALMSALDLVSEIIEANTVAKKRFVAKNGHPVALPGSPLELLTSPL
FSMGDLWHLAREAWIKPVNKEETIAEFVRRRLGQGFLDWAVDPFVSGVYAGDPNRLSVQA
AIPKIYAFEQESGSLIRGGIAKMKAAKANPAPVTLPAKGKLFSFKRGLQTLTDALATAIT
SSGRGNIQLDSAITNIQRLPEGGWSVKTVQGKTFHTRQLILSTPAHVSAQLLGEVDGPLA
ETLAAIEYPPVTSVVMGFDRSEVAHPLDGFGLLLPSKEKKRTLGVLFSSTLFPDRTPAGK
VLLSAFIGGRKHPEAAQGDDQELLDRVLGDLSPLLGIKGKPEFLRVKRWQQAIPQYEIGY
LELQEKISQRLTALPGLSLNGNWRGGIAVGDCLNNGNKLAERLIENTRTEES
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacccattcgaacgcttcagaaccaatcaattgtccttatctcgtcatcggtggc
ggcatcagtggtctggcaaccgcttaccacctctccagaatgggcaaaacggtcactgta
ttggaagcgacctctcgcgtaggcggcgccgtgggaagcatagaagaggacggctggtta
cgcgaactcgggcccaacagcctggtgcaaacaccggaaatggccgcactgatgagcgcg
cttgatctggttagcgaaatcatcgaagccaacacggtggccaaaaagcgattcgtagcc
aaaaacggccaccccgtggcgttgccggggagccccttagaactgctcaccagcccgctt
ttcagcatgggcgatctgtggcacctggcgcgcgaagcctggataaaacccgtcaacaag
gaagagaccatagccgaattcgtgcgacgacgcctgggccaaggctttctcgactgggct
gtcgatcccttcgtttcgggcgtgtatgcgggcgatccgaaccgactttccgtgcaggca
gctattcctaaaatctatgcttttgaacaagagtcaggctctctgattcgcggcggcata
gcaaaaatgaaagcagccaaagccaacccggctccggtcaccctgcctgcgaagggcaaa
ctgttcagtttcaagcgagggctacaaacactcaccgacgcactggcaacagccatcacg
tcttcgggccggggcaacatccagctggactctgccatcaccaacatccagcggctgccc
gagggcggttggtccgtgaaaacagttcaaggtaaaaccttccataccagacaactcata
ttgagcacacccgcgcatgtcagcgctcaattgcttggcgaagtcgatggtccactggcc
gaaacgctggctgccattgaatacccgcccgtcacatccgtcgtcatggggttcgatcgg
tctgaagtagcgcatccactggatgggtttggcttgctgctgccttccaaggagaaaaaa
cgcaccttgggcgttctgttctcctcgacgctatttccggatcgcacgccggcgggcaaa
gtactcctttctgcctttatcggcggacgcaagcacccggaagcggcacaaggggacgat
caagaactcttggatcgtgttctgggtgatctatcgccgctgctcggcatcaagggcaag
cctgaattcttgcgcgtgaaacgttggcaacaggccattccgcaatacgagattggctat
cttgaattacaagagaagatttcccagcggctaaccgcactaccgggattgagcctgaac
gggaattggcggggcggcatcgcggtcggcgactgcctgaacaacgggaataagctggca
gaacgcctgatcgaaaacacccgcacggaagaatcttga

DBGET integrated database retrieval system