KEGG   Halothiobacillus neapolitanus: Hneap_0735Help
Entry
Hneap_0735        CDS       T01104                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hna  Halothiobacillus neapolitanus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Hneap_0735
   00052 Galactose metabolism
    Hneap_0735
   00500 Starch and sucrose metabolism
    Hneap_0735
   00520 Amino sugar and nucleotide sugar metabolism
    Hneap_0735
Enzymes [BR:hna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Hneap_0735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(796769..797590)
Genome map
AA seq 273 aa AA seqDB search
MIRKCLFPAAGYGTRFLPATKVMPKEMLPILDRPLIQYGVEEAMEAGIKNMAIVTGRGKR
ALEDHFDVNYELEHQIRGTSKASLLTSIDKLIENCTFSYTRQIAMLGLGHAILTGEPLIG
KEPFAVVLADDLCVGSPKGVLSQMVEIYERHKCSVVAVEEVPMTEVHKYGVIAGTPIDED
TLQVSQMIEKPAADQAPSNLAIIGRYILTPDIFDILEATKAGAGGEIQLTDALRTQAEQG
KVVAYKFKGQRFDCGSPSGFVAATNHFYHLSRR
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcaaatgcctgtttcccgccgccggctacggtactcgttttctaccggcgacc
aaggtcatgcccaaggaaatgttaccgattctcgaccggccattgattcagtacggggtc
gaggaagccatggaagcgggcatcaagaacatggccattgtcaccggccggggcaagcgg
gcgttggaagatcatttcgatgtgaactacgaactcgagcatcaaatacgcggcacatcc
aaggcaagcctgctcaccagcatcgataaacttatcgaaaactgcactttttcatacacc
cgccagatcgccatgctgggtttgggccacgccatcctcaccggcgagccgctgatcggt
aaagaacccttcgctgttgtgctggccgatgacctttgtgtaggcagtccgaaaggcgta
ctgagccagatggtcgaaatatatgagcgtcacaagtgcagcgtagtggccgttgaagaa
gtacccatgactgaagtgcacaaatatggcgttatcgcgggcacaccaattgacgaggac
acgcttcaggtgagccagatgatcgaaaaaccggccgcggatcaggcaccgagcaatctc
gccatcatcggtcgctacatccttacacccgatattttcgatattctcgaagcgaccaag
gcaggggccggcggtgaaatccagctcaccgatgccttgcgcacccaggcagaacaaggc
aaagtcgttgcttataagttcaaggggcaacgttttgactgcggcagcccctcgggtttt
gtggctgcaaccaaccatttttaccatctgagccgtcgttaa

DBGET integrated database retrieval system