KEGG   Halothiobacillus neapolitanus: Hneap_0771Help
Entry
Hneap_0771        CDS       T01104                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hna  Halothiobacillus neapolitanus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hna03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
828543..829136
Genome map
AA seq 197 aa AA seqDB search
MFSPKFVALVQALRGLPSVGQKTAQRMALQLLEHDREGAAQLARAIVAALEGIGRCESCR
IFSETPVCPVCADNHRDATQLCIVESPTDWLAIEQSGAYQGLYFILSGHLSPLDGIGPED
IGIPELMNRLANSPVEEIIMATSATIEGEATAGYIMDRVDPARYKVTRLAQGVPMGGELE
YLDAQTLSLALKSRRSV
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgttctcgcccaagttcgtcgcattggtccaggccctgaggggattgccttcggtcggg
cagaaaacagctcagcgcatggctttgcagttgctcgaacatgaccgggaaggggcggcc
caacttgcaagggcgatcgttgcggcgcttgagggtatcggtcgctgcgaatcctgccgc
atattttctgaaacgccggtttgcccggtttgcgcggataaccacagagatgcgacacag
ctctgcattgtcgaatcaccgaccgattggttggcgattgaacaatccggtgcataccag
gggctgtactttatcctgtcgggccatttatcacccttggatggcatcggcccagaagac
atcggtattcccgaattgatgaaccgattggcaaacagcccggttgaagaaatcatcatg
gcgacaagcgcgacgatcgaaggtgaagccaccgcaggctacatcatggatcgggttgat
cctgcacgctacaaggtaactcgactggcacagggcgtgcccatggggggagagctggaa
tacctcgatgcccaaacattgagtctggcgcttaaatcaaggcgttccgtataa

DBGET integrated database retrieval system