KEGG   Halothiobacillus neapolitanus: Hneap_0775Help
Entry
Hneap_0775        CDS       T01104                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
hna  Halothiobacillus neapolitanus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hna00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(833167..835332)
Genome map
AA seq 721 aa AA seqDB search
MQLDFQPIIESRMHDPFSLLGRHPLGEGKCRFHTYQPQAEHIRILSTHGEWLELTADADF
PGVFAGLFTEDLLPLHPVLEIETAEHHKYQITDPYSFGPVLGELDLYLFGEGKHYDLWKV
LGAHVITIDGVEGVTFAVWAPNASRVSVVGDFNNWDGRRHPMRNRISSGVWELFIPGLSA
GDFYKFEIKNRDTQATSVRTDPFGRSFELRPNTAAKVVSDEEFQWTDQFWLKAREQNDWM
HAPMNVYEVHLGSWKLTGKQFPTYAELAEQLIPYVKERGYTHIELLPITEHPFDGSWGYQ
TTGYFAPTSRFGTPEQFKQFVNKAHEAGIGIILDWVPAHFPRDEFALARFDGTALYEHED
PRRGEHRDWGTLIFNYGRKEVSNFLIASALYWLEEMHLDGLRVDAVASMLYLDYSREHGD
WLPNAYGGRENLEAIDFLRALNHVTQSRNPGALMMAEESTAWPLVSRPPEVGGLGFALKW
NMGWMNDTLKYFQEDPINRQYHHNNLTFGLLYTFTENFVLPFSHDEVVHGKGSLLNKMPG
DEWQKFANLRLLLAYQCAYPGKKLLFMGCEFGQGNEWNHAKQLDWWMLEYKLHQGISQLS
TALNHLYKNEVALHYHDFEGCGFSWNDCNDRQNSVISFFRHAKGQSILTILNFTPVVRQN
YKIGIPNTDRLNIVFNSDESVYGGSATALELTHHKNSPYNGQSGHIELTLPPLGALMIRI
N
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgcagttagattttcaacccattatcgaatcgagaatgcatgatccgttttccttgcta
ggccgccatccacttggcgagggcaaatgccgctttcacacctaccagccgcaggccgaa
cacatcaggatattgagcactcatggcgagtggcttgaattgacagccgatgccgacttc
cccggtgtatttgctgggctcttcaccgaggacttgctgcctcttcacccggttctggaa
atcgaaactgctgaacaccacaagtaccagatcacggatccctacagcttcgggccagta
ctcggcgaactcgacttgtacttattcggcgaaggcaagcactacgacctgtggaaagtg
ctgggcgcacatgtcatcaccattgacggcgtggagggcgtaacattcgccgtatgggct
cccaatgccagccgcgtcagcgtcgtgggcgatttcaacaactgggatggccgccgccat
ccgatgcgcaatcgcatcagtagtggcgtttgggagttgtttatcccgggcctttctgcc
ggcgatttttataagtttgaaatcaaaaacagagatactcaggccaccagcgttcgcact
gatccctttggccgcagctttgaacttcgccccaatacggccgccaaggtagtcagtgac
gaagaattccagtggacggatcaattctggctcaaggcgcgcgagcaaaacgactggatg
cacgccccgatgaatgtctatgaagttcacttaggttcttggaaactgacgggcaaacaa
ttcccaacctacgcggaattggcggagcaactgattccgtatgttaaagagcgcggttac
actcacattgaattgctgcccatcacggagcaccccttcgatggctcatggggttatcaa
accacaggctatttcgcgccgacctcccgtttcggcacgccggaacaattcaagcagttc
gtcaacaaggcacacgaagcaggcataggcattattcttgactgggttccggctcacttt
ccccgcgatgagtttgccctcgcccgcttcgatggcacggcactttatgagcacgaggac
ccaaggcgcggggaacaccgtgactggggtaccctgatcttcaattacgggcgcaaggag
gtcagcaattttttgattgcttccgccctgtactggctcgaagaaatgcatctcgatggc
ctgcgtgtcgatgctgtggcatccatgctgtatctcgattattcacgcgaacatggcgat
tggctgccgaacgcctacggcgggcgcgaaaacttggaggccattgattttcttcgtgca
ctgaaccatgtgacacaaagccggaaccccggcgccttgatgatggcggaagaatccacc
gcctggccattggtgtccaggccgcccgaggtcggcgggcttggattcgcattgaaatgg
aacatgggctggatgaatgacacgctgaaatactttcaggaagaccccatcaaccggcaa
tatcaccacaacaatcttacattcggcctgctctacaccttcacggagaacttcgtcctt
cccttttcgcacgatgaagtcgtgcatggtaaaggctcgttgctgaacaaaatgcccggt
gacgaatggcagaaattcgccaatcttcgccttcttctggcctaccaatgcgcctatcca
ggaaagaaactcctgttcatgggctgcgaattcggccagggcaacgagtggaatcatgcc
aagcaactcgactggtggatgcttgaatacaaactccatcaaggcatcagtcaactcagc
acggcactcaatcacctctataaaaatgaagtggcactgcattaccatgattttgaagga
tgcgggttttcatggaacgactgtaacgaccgccagaactcagtcatcagttttttcagg
cacgccaaaggccagagcatcctgaccatacttaatttcacgcccgtcgtcagacagaac
tacaaaatcggcataccgaataccgaccggttgaatatagtattcaattccgacgagtct
gtttatggcggctcagccaccgcattggaattaactcaccacaaaaacagtccttataat
ggtcaaagtggccatatagaactgacactaccgccacttggcgccctgatgatcagaata
aattga

DBGET integrated database retrieval system