KEGG   Halothiobacillus neapolitanus: Hneap_0778Help
Entry
Hneap_0778        CDS       T01104                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
hna  Halothiobacillus neapolitanus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Hneap_0778
Enzymes [BR:hna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Hneap_0778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
838718..840190
Genome map
AA seq 490 aa AA seqDB search
MGKESTKEKKILPEMPCALRRAGVLAPVFSLPSGDFGPSVDQFLTFMNQSRLTVWQVLPL
GPPLMDGSPYQCASSFAINPAFLSDALLLNPDDFDPIAPIRERRAGQGALPSLLAEFDEF
CRASSNWLDDYALFIVIKSHEQGRSWLEWRPVWRDRDPASLEAFAQDHAKAVHAVKFEQF
LLDRQWRRIVTRAHELGVLIYGDLPIFVAGDSADVWANRAFFQLDERGLPTEVAGVPPDY
FSATGQRWGNPLFDWSRMAADGFSWWKQRMARHIDMFDWVRIDHFRGLAAYWSIPAQCDT
AIDGRWVEAPGAALLTALSEAFGGDLPIIAEDLGVITEDVTALRKAFGMPGMLILQFAFD
SDDDNPYLPANHHPDSVVYTGTHDNDTTLGWWQSLSPDAQAHMYDVLAQQLNLSSSEPMP
MALLRAAMASVAQLAIIPMADWLGCDSSGRINTPGTPTGNWTWQFERADMSAELSKRIRA
LVTEYQRDPD
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagagtcgaccaaagagaaaaaaattttgcctgaaatgccctgtgcccttcga
agagcgggcgttttggctcctgttttcagcctgccatcgggtgatttcggcccctcggtg
gaccaatttctgacgttcatgaaccaaagccgcctgactgtttggcaggttttgccgctc
gggccgccacttatggatggttccccctatcagtgcgcgtcttcttttgcgattaatccg
gcattcctctctgatgcgctgttgctcaatcccgatgattttgaccctatcgccccgatc
cgtgaacgaagagccgggcagggcgctttgccatccctgttggccgaattcgacgagttc
tgtcgtgcgtcgtccaactggcttgatgattacgccttattcatagtcatcaagtcccat
gaacaggggcggtcttggctggagtggcgaccggtttggcgagatcgtgatccggcctct
cttgaggcctttgcacaggatcatgcgaaagcggttcatgccgtgaagttcgaacagttc
ctgctggatcgccagtggcggcgtattgtcacgagggcgcatgaactcggcgttttgatc
tatggtgatctgccgatttttgtggccggtgattcggccgatgtttgggcgaatcgggca
tttttccaactggacgaacggggtttgcccaccgaggtggccggcgttccgcccgactat
ttctctgcaacggggcagcgctggggcaatccgctttttgattggtcccgaatggcggcc
gatgggttctcttggtggaaacagcgaatggcccgccacatcgacatgttcgactgggtg
cggattgaccattttcgtgggctggcggcgtactggtccattcccgctcagtgcgatacg
gcgatcgatggccgctgggtcgaagcgccgggtgccgctttgttgacagctttgagcgag
gcgtttggcggtgatctgcccatcatcgcggaagatcttggggtgatcaccgaagatgta
accgctttgcgcaaggcattcggcatgccgggcatgctcatcctgcagttcgcctttgat
agcgacgacgataacccctatctgcccgccaatcaccaccctgattcggtcgtatatacc
ggaacgcacgataacgatacgacgctgggttggtggcagtcgctcagcccggatgcacaa
gcgcatatgtacgacgtgctcgcgcagcaattgaatctgtcgagttcagagccaatgccc
atggcgcttcttcgtgcggcgatggcctcggttgctcaattggctattattccgatggcc
gattggctgggttgtgattcgagcgggcgaatcaatacgccgggtacaccgacgggcaat
tggacctggcagtttgaacgtgccgacatgagtgccgagttatcgaaacgtatccgcgct
ttggtgacagagtatcagcgcgatcccgactga

  All links  
No link information was found.   
DBGET integrated database retrieval system