KEGG   Halothiobacillus neapolitanus: Hneap_0778Help
Entry
Hneap_0778        CDS       T01104                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
hna  Halothiobacillus neapolitanus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hna00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
838718..840190
Genome map
AA seq 490 aa AA seqDB search
MGKESTKEKKILPEMPCALRRAGVLAPVFSLPSGDFGPSVDQFLTFMNQSRLTVWQVLPL
GPPLMDGSPYQCASSFAINPAFLSDALLLNPDDFDPIAPIRERRAGQGALPSLLAEFDEF
CRASSNWLDDYALFIVIKSHEQGRSWLEWRPVWRDRDPASLEAFAQDHAKAVHAVKFEQF
LLDRQWRRIVTRAHELGVLIYGDLPIFVAGDSADVWANRAFFQLDERGLPTEVAGVPPDY
FSATGQRWGNPLFDWSRMAADGFSWWKQRMARHIDMFDWVRIDHFRGLAAYWSIPAQCDT
AIDGRWVEAPGAALLTALSEAFGGDLPIIAEDLGVITEDVTALRKAFGMPGMLILQFAFD
SDDDNPYLPANHHPDSVVYTGTHDNDTTLGWWQSLSPDAQAHMYDVLAQQLNLSSSEPMP
MALLRAAMASVAQLAIIPMADWLGCDSSGRINTPGTPTGNWTWQFERADMSAELSKRIRA
LVTEYQRDPD
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagagtcgaccaaagagaaaaaaattttgcctgaaatgccctgtgcccttcga
agagcgggcgttttggctcctgttttcagcctgccatcgggtgatttcggcccctcggtg
gaccaatttctgacgttcatgaaccaaagccgcctgactgtttggcaggttttgccgctc
gggccgccacttatggatggttccccctatcagtgcgcgtcttcttttgcgattaatccg
gcattcctctctgatgcgctgttgctcaatcccgatgattttgaccctatcgccccgatc
cgtgaacgaagagccgggcagggcgctttgccatccctgttggccgaattcgacgagttc
tgtcgtgcgtcgtccaactggcttgatgattacgccttattcatagtcatcaagtcccat
gaacaggggcggtcttggctggagtggcgaccggtttggcgagatcgtgatccggcctct
cttgaggcctttgcacaggatcatgcgaaagcggttcatgccgtgaagttcgaacagttc
ctgctggatcgccagtggcggcgtattgtcacgagggcgcatgaactcggcgttttgatc
tatggtgatctgccgatttttgtggccggtgattcggccgatgtttgggcgaatcgggca
tttttccaactggacgaacggggtttgcccaccgaggtggccggcgttccgcccgactat
ttctctgcaacggggcagcgctggggcaatccgctttttgattggtcccgaatggcggcc
gatgggttctcttggtggaaacagcgaatggcccgccacatcgacatgttcgactgggtg
cggattgaccattttcgtgggctggcggcgtactggtccattcccgctcagtgcgatacg
gcgatcgatggccgctgggtcgaagcgccgggtgccgctttgttgacagctttgagcgag
gcgtttggcggtgatctgcccatcatcgcggaagatcttggggtgatcaccgaagatgta
accgctttgcgcaaggcattcggcatgccgggcatgctcatcctgcagttcgcctttgat
agcgacgacgataacccctatctgcccgccaatcaccaccctgattcggtcgtatatacc
ggaacgcacgataacgatacgacgctgggttggtggcagtcgctcagcccggatgcacaa
gcgcatatgtacgacgtgctcgcgcagcaattgaatctgtcgagttcagagccaatgccc
atggcgcttcttcgtgcggcgatggcctcggttgctcaattggctattattccgatggcc
gattggctgggttgtgattcgagcgggcgaatcaatacgccgggtacaccgacgggcaat
tggacctggcagtttgaacgtgccgacatgagtgccgagttatcgaaacgtatccgcgct
ttggtgacagagtatcagcgcgatcccgactga

DBGET integrated database retrieval system