KEGG   Halothiobacillus neapolitanus: Hneap_1000Help
Entry
Hneap_1000        CDS       T01104                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hna  Halothiobacillus neapolitanus
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hna00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1079417..1080931
Genome map
AA seq 504 aa AA seqDB search
MSQYIGAIDLGTTSSRFIVFDRAGQIVSMAQKEHRQIYPQPGWVEHDPMEILHNVNEVTG
AALAKAGLNAGDLAAIGITNQRETTVLWDKASSKPVHNALVWMDTRTDALVSSFAKFGGK
DRFRAQTGLPLTTYFSGLKLRWLLDQLPEARTRAENGDLLFGTMDSWLIWHLTGGTRGGR
HITDVTNASRTQLMNLATCKWDEDILEAFAIPKACLPQILPSSQIYGEVTTVPLRGTPIA
GILGDQQAALVGQTCFVPGEAKNTYGTGSFLLMNTGRKIVPSQAGLLTTVAYQFGDEPPC
YALEGSIAITGALVQWLRDNLNLIEKAADIEPLAASVEDNGGVYIVPAFSGLYAPYWKDD
ARGVIVGLTRYANRAHIARAALESAAFQVRDVVEAMQADSGIELKALRVDGGMVCNNLLM
QFQSDMLAAPVVRPRITETTALGAAYAAGLAVGYWKNTDDLRANWSVDHTWSPIMPNEQR
ETYYRYWKRAVTRSFDWVEDKPET
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagtacatcggcgccattgatttggggacaaccagttcccggtttatcgtcttc
gaccgcgccgggcagattgtgtccatggcgcagaaagaacatcggcagatctaccctcag
ccgggctgggtggagcacgacccgatggagatcctgcataacgtgaatgaagtgaccggc
gccgcgctcgccaaagcagggctgaatgcaggcgaccttgccgcgatcgggatcaccaat
cagcgtgaaaccaccgtgctgtgggataaggccagcagtaagccggtgcacaatgccttg
gtttggatggatacgcgaaccgatgccttggtgtcctcgtttgccaagttcggcgggaag
gatcgctttcgtgcccagacgggtttgccgttgactacctatttctccgggctgaaatta
cgctggctgctcgatcaactgcccgaagcacgtactcgtgccgagaacggtgaccttctg
ttcggcacgatggattcctggctcatttggcacctgaccggcggtacgcgaggcggtcgg
catatcaccgatgtcaccaatgccagtcgcacccagttgatgaaccttgcgacctgcaag
tgggatgaggacatactcgaagcgttcgccattcccaaagcctgtttgccacaaatccta
ccgtcgtcgcaaatctatggcgaagtaactaccgttccgttacgtggcacgccgatcgcg
ggcattctgggcgatcaacaagccgccttggtcgggcaaacctgttttgtgcccggagaa
gccaaaaacacctacggtaccggctcatttttgttgatgaataccggtcgcaagatcgtg
ccttcgcaggcgggattgctaacaaccgtcgcctaccagtttggtgacgagcccccatgt
tatgcgcttgaaggctccatcgcgattacgggcgccttggtgcaatggctgcgcgataac
ctcaatctgattgaaaaagcggccgatatcgagcccctggcggccagtgtggaagataac
ggtggcgtctacatcgttccggccttttccgggttgtatgcgccctactggaaggacgat
gcacgtggcgttatcgtcgggctgacacgctatgccaaccgggcacatatcgctcgagcg
gcgctggagtcggcggctttccaggtgcgcgacgtcgtcgaggcgatgcaggccgatagc
ggcatcgagctcaaagccctaagggtggatggcggcatggtctgcaataatcttttgatg
caattccagtcggatatgctcgctgcgcccgttgtccggccccggatcaccgagaccaca
gccttgggcgccgcctatgctgccggtttggccgtcggctactggaaaaatacggatgac
ctgcgagcgaactggtcggttgaccacacctggtcgcccataatgccgaatgaacagcgc
gaaacctactatcgttattggaagcgtgcggtaactcgttcgttcgattgggtagaagac
aagcccgagacgtaa

DBGET integrated database retrieval system