KEGG   Halothiobacillus neapolitanus: Hneap_1109Help
Entry
Hneap_1109        CDS       T01104                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hna  Halothiobacillus neapolitanus
Pathway
hna00860  Porphyrin and chlorophyll metabolism
hna01100  Metabolic pathways
hna01110  Biosynthesis of secondary metabolites
hna01120  Microbial metabolism in diverse environments
Module
hna_M00121  Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hneap_1109
Enzymes [BR:hna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Hneap_1109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ACX95945
JGI: Hneap_1109
UniProt: D0KZS2
Position
complement(1202192..1203046)
Genome map
AA seq 284 aa AA seqDB search
MQDINPNQFSGRTIALPESRQLDVLAALFERRGAAIRRCPLVSIHDAPDQAPIIAWIRAF
IADATMTDLIILTGEGITRLIQAAKRTGLVDAFLQKLSTTRLIVRGPKPGRALKTWGLQP
SIQAVEPTSAGIITTLFTLPALSPRIGVVLYGTEENAPLQAAITALGATPVPVAPYIYAS
ESETGAVLALIEELAQGQIDALAFTSQPQYKRLASVAKAHDCEQQLERGLARVRIAAIGP
IMANYLIEHGVKVDVVPDGRFFMKPLVDALADHWAHAALERSPQ
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacattaatcccaatcagttctctggccgcaccatcgccctgcccgaatcaagg
cagctggatgtgttggccgccctattcgaacgccggggggctgcgattcgccgctgcccg
ctggtcagtattcacgacgcgccggatcaagcgcccatcatcgcctggatacgcgcgttt
atcgccgatgccacgatgaccgatctcattatcctgaccggtgaggggattactcgcttg
attcaagccgctaaacgcaccggtttggtggacgcgtttttgcaaaaacttagcaccacc
cgattgattgtgcgcggcccaaaaccgggccgtgcgctgaagacctgggggttacaaccc
agcattcaggccgtagaacccaccagcgcgggcattatcaccaccttatttaccctgccg
gccttatctccccgcatcggcgtggtgttgtacggaaccgaagaaaacgcgccactgcaa
gcggccatcaccgcgctcggtgccacgcccgtacccgtcgccccgtacatttacgccagt
gaatccgagaccggtgccgtgctggcgctaattgaagaattggctcaagggcaaatcgac
gccctggcatttaccagtcaaccccaatacaaacggctggccagtgtggccaaagcacac
gactgcgaacagcaacttgaacgcggactggcgcgcgtgcgcatcgcggccattggcccg
atcatggcgaactatctgatcgagcacggcgtaaaggtagatgtcgtgcccgacggtcgg
tttttcatgaagccgctcgtggatgcgctggccgaccattgggcgcatgcggcccttgag
aggtcgccacaatga

DBGET integrated database retrieval system