KEGG   Halothiobacillus neapolitanus: Hneap_1132Help
Entry
Hneap_1132        CDS       T01104                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hna  Halothiobacillus neapolitanus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Hneap_1132
Enzymes [BR:hna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Hneap_1132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1232325..1232879
Genome map
AA seq 184 aa AA seqDB search
MRPATDTPRSPDSESDNVHAFIALGSNLDQPVKQLVDAMSALDGLPGTDVLRTSQMYANP
PMGPQDQPDYVNAVALISTSLTPGALLQALKGLEQSAGRLSTQAWGARVLDLDILTYGEM
TMNTPTLTIPHPGIAKRRFVLAPWHEIAPDTRLPDGRLIAELLSSAPEHPLHIVAPSTIS
QKRH
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccggccacagacacgccccgttctcccgattctgaatcagacaatgtccatgca
ttcatagctctgggcagcaatcttgatcagccggtcaagcaacttgtggatgccatgtcc
gcgcttgatgggttaccgggcaccgacgtgttgcgaacatctcaaatgtacgcaaatcct
ccgatggggccgcaggatcagccggattatgtcaacgcagtcgccttgatctcaaccagc
ctgacacccggcgcattgttgcaggcactcaagggtctggagcaatccgcagggcggctt
tccactcaggcatggggtgcgcgtgtgctggatctggacattctgacgtacggcgaaatg
accatgaatacacccaccttgaccattccacaccccggaattgccaaacgccgctttgtt
ctggcaccttggcatgaaattgcaccggatacccggttgcctgatggccgtcttattgcg
gagctgctgtcatctgcgcccgagcacccattgcatatcgttgctccctcaacgatttca
cagaaaaggcattaa

DBGET integrated database retrieval system