KEGG   Halothiobacillus neapolitanus: Hneap_1167Help
Entry
Hneap_1167        CDS       T01104                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hna  Halothiobacillus neapolitanus
Pathway
hna00900  Terpenoid backbone biosynthesis
hna01100  Metabolic pathways
hna01110  Biosynthesis of secondary metabolites
hna01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Hneap_1167
Enzymes [BR:hna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Hneap_1167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACX96003
JGI: Hneap_1167
UniProt: D0KZY0
Position
1271640..1272539
Genome map
AA seq 299 aa AA seqDB search
MITDAPTQWLAPVKINLFLHINSKIPEGTFRGYHELQTYFQRLDYGDYLTFECIEEPTIS
VQWLEGDESVALKPVQERNDLIYRAAALLQEAASARGLPRQGVRITLTKNTPVGGGLGGG
SSAAATTLLALNQLWEISLPIAELLPLACPLGADVPFFLYKTNAWAEGIGDRITPYPSPV
AGKWFLIVVPKTRTLTAQGFAHPKLIRNEAKVAPSDLAEHWNKSSYNAFEACAIAEDPAI
AACDKALRNATGFSRLTGSGACLFSPVENHATAQQVADILIRDTLQIQRIIIARALPDK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgatcacagacgcaccaacccaatggctagctcccgtcaaaatcaatctgtttttgcat
atcaacagcaagattcccgagggaacatttcgtggttatcacgagttgcaaacctatttt
caacgcctggattacggcgattacttaacgtttgaatgcatcgaagagcccactatctcc
gtgcagtggctcgaaggcgacgaatctgttgccctcaaacccgtgcaggagcgtaatgat
ttgatctatcgggctgcagccctgcttcaagaggccgcaagcgcccgggggcttccacgc
cagggcgtacgaataacacttacgaaaaacaccccggtgggcggtggactcggtggaggc
tcatctgcggcggcgacaacgctgctggcgctcaatcagctctgggaaatatcattgccg
atagcagaactgctaccacttgcatgcccactgggggcagacgtaccgttttttctctat
aaaaccaacgcttgggctgagggaatcggtgaccgcataacaccctatccaagtcctgtg
gccggaaaatggtttttgattgtcgtgccaaaaacacgcaccttgacagcacaggggttc
gcccatccgaaactcatcaggaatgaagcgaaggttgcgccttcagatctggccgaacat
tggaataaatcaagctacaacgcattcgaagcatgcgcaatcgcggaagatccggccatc
gcagcctgcgacaaggcccttcgtaatgccaccggtttttcccgcctgaccggcagtggc
gcctgcctgttttcgccggtggaaaaccatgcaactgctcagcaagttgctgatatattg
attcgggacacgcttcagatacagcggatcatcattgctcgcgcactgccagacaaatag

DBGET integrated database retrieval system