KEGG   Halothiobacillus neapolitanus: Hneap_1172Help
Entry
Hneap_1172        CDS       T01104                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hna  Halothiobacillus neapolitanus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hneap_1172
Enzymes [BR:hna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Hneap_1172
Exosome [BR:hna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Hneap_1172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1276519..1277529
Genome map
AA seq 336 aa AA seqDB search
MINRPFPAHRPRRMRRDDFSRRMMQENTLSANDLILPVFVLEGQGEQEPISSLPGIYRQS
IDLLLDTADRAQSLGIPALALFPVTPMSAKSPNAEAAYDPDGLVQRTIRELKNTFPNLGI
MTDVALDPYTTHGQDGLTDANGYVLNDETTEVLVKQAQSHAAAGADIVAPSDMMDGRIGA
IRQQLEAAGHIHTRIMAYSAKYASSFYGPFRDAVGSAGNLGKADKKTYQMDPANSDEALH
EVAMDLAEGADMVMVKPGMPYLDIVRRVKTELKVPTFAYHVSGEYAMLRAAADNGWLDWR
KCLLETMMGFRRAGADGVLTYAALDVAEYLAVGDIQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgattaatcgccctttccccgcccaccgtccgcgtcgcatgcgtcgggatgatttcagt
cggcgcatgatgcaggaaaacaccctctcagcgaatgacctgattctcccggtattcgtt
ctcgaagggcaaggggaacaggaaccgatttcatctttgccgggcatttatcgacagagt
atcgatttgctgctggatacagccgatcgggcgcaaagcctcggtattccggccctcgct
cttttcccggtcacgccaatgagcgccaaatcgcccaatgccgaagccgcctacgacccg
gacggcttggttcaacgcacaatccgcgaattgaagaatacattcccgaatctgggcatc
atgaccgatgtcgcactcgatccgtacaccacgcatggacaagatggcctgaccgatgcc
aatggttatgtgctgaatgacgaaacgactgaagttctggtcaaacaagcgcagtcacac
gccgcagccggggctgatatcgtggccccctccgacatgatggatggccgcatcggtgcc
atccgtcaacaactggaggctgcaggacacatccatacccgaatcatggcctacagtgcg
aagtatgcttcgagcttttacggtccattccgtgatgcggttggttctgccggcaatctg
ggcaaggccgataaaaaaacctaccagatggatccggccaactccgatgaagccctgcat
gaggtggccatggatttggccgaaggcgcggacatggtcatggtcaagccggggatgccc
tacctcgacatcgtacggcgtgtcaaaaccgagttgaaagtgcccacctttgcttaccat
gtctcaggggagtacgccatgctccgcgcagcagccgacaacggctggctcgattggcgc
aaatgcctgctggaaaccatgatgggcttccgtagagcgggagcagacggtgttctgacc
tatgccgcactggatgttgcagagtacttggctgtgggcgacatccaataa

DBGET integrated database retrieval system