KEGG   Halothiobacillus neapolitanus: Hneap_1238Help
Entry
Hneap_1238        CDS       T01104                                 

Definition
glucosamine/fructose-6-phosphate aminotransferase
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
hna  Halothiobacillus neapolitanus
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hna00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hna00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1340703..1342544)
Genome map
AA seq 613 aa AA seqDB search
MCGIVAAVAQRPVWPILIEGLRRLEYRGYDSAGLAVLDPAGGLSSARAVGKVQALCDQIG
EEGLAGFSGIAHTRWATHGVPAERNAHPHIASKRVAVVHNGIIENHAALREQMVAEGRIF
SSDTDTEVIAHLLDHYLVAGQTPQKAFELTLDRLHGAFALAILIKDVPNQIFVARQGSPL
VIGVGIGELFAASDALALLPVTQRFIYLCEGDRAILSCDHLEVTDRTGQIVARAIVESAQ
RADSAGRGGYKHFMLKEIHEQPRAIADTLEGRISEGRVLPAAFGVNAEAVFKTIKRIQIV
ACGTSYHAGMVARYWFEDILRLPAAVEVSSEFHYRNPVLEEGTLLVMLSQSGETADTLAA
LRMVRVRSPQMPILAICNAPESSLVRESDLVLMTHAGPEISVASTKAFSTQLVALALLML
SIGRIRAILSEQDERRIVAGLEKIPNLARDALQHDEAIMALAERLVDKQHALFLGRGVMF
PIALEGALKLKEISYIHAEGYPAGELKHGPLALIDENMPVITIAPQNDLLDKLKSNMSEV
AARGAELFVFADERSGLRTEARLHVLPVTSHVGRISAPIIFNLPLQLLAYHVAVLKGTDV
DQPRNLAKSVTVE
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcgtggcagccgttgcccaacgaccggtttggcctatcctcatcgaaggg
ttgcgccgtcttgaatatcgtgggtacgactcggcaggtcttgccgtgcttgatccggct
ggtgggttgagttcggcgcgtgcagttggcaaggttcaggccttgtgcgatcagatcggt
gaggaagggcttgccggtttctcaggcattgcgcacacgcgttgggcaacacatggcgtt
ccagccgaacgaaatgcccacccgcatatcgcatcaaagcgtgtggctgtggtgcataac
ggcatcatagaaaatcatgctgccttgcgtgaacagatggtggcagaaggtcggatattc
agctcagatacagatactgaagtgatcgcccatttgctcgatcactaccttgtggcagga
caaacaccgcaaaaggcttttgagctgacgcttgatcggttgcatggcgcctttgcgctc
gcgatcctgatcaaagatgtaccgaaccagatattcgtggcgcgccaaggcagcccgctg
gttatcggtgtcgggattggtgaactgttcgcagcttcagatgctctggcacttttgccg
gtgacgcagcgatttatttatctgtgcgaaggcgaccgggcgattctttcctgtgatcat
ctcgaagtgactgatcgcacggggcagattgtcgcgcgtgccattgtggaatccgcgcag
cgggcagacagcgcggggcgtggtggctataagcatttcatgctcaaggaaatccacgag
cagccgcgcgctattgccgatacacttgaaggccgaatcagtgaagggcgggttcttcct
gccgcgttcggcgtgaatgccgaagccgtgttcaaaacaatcaaacgcatccagattgtc
gcctgcgggacgagttaccacgcgggcatggtggcgcgttactggtttgaagatattctt
cggttacccgccgcagttgaggtttcttcagaatttcattaccgcaatcccgtcttggaa
gagggaacgttactggtcatgctctcgcagtccggcgaaacggcggacaccttggccgct
ttgcgcatggtacgggtacgcagtcctcaaatgcccattctggcaatatgcaatgcgccg
gagtcatctctggtacgtgaatccgatctcgtcttgatgacgcatgccggcccggaaatc
tcggtcgcgtcaaccaaggctttttcgacccagctcgttgcgctggccttgctgatgctt
tccatcggacgtatcagggctatcctgagcgagcaggacgaacgtcggatcgtggctggt
cttgagaaaatcccaaatcttgcccgtgatgccctgcaacacgatgaggccatcatggcc
ttggccgagcgattggtcgataagcagcatgcgcttttcctggggcgtggcgtgatgttc
ccaatcgcgctggaaggtgcgttgaagcttaaggaaatcagttatatacacgcggaaggt
tatccggcgggtgagctcaagcacggtccgctggcgctgatcgacgagaatatgccggtg
atcaccattgccccccagaacgacctgcttgataaactcaaatcgaacatgtcggaggtt
gctgcacggggcgcggagttgttcgtatttgcagatgaacgatccggattgcgcacagaa
gcgcgcttgcatgtattgccggttacatcccacgttggcaggatatctgcgccgatcatt
ttcaatttgccgctgcaattattggcttatcatgtcgccgtattgaaaggcaccgatgtg
gatcagccacgtaatcttgccaaatcggtcacagtagaatga

DBGET integrated database retrieval system