KEGG   Halothiobacillus neapolitanus: Hneap_1290Help
Entry
Hneap_1290        CDS       T01104                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
hna  Halothiobacillus neapolitanus
Brite
Enzymes [BR:hna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Hneap_1290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1395345..1396406
Genome map
AA seq 353 aa AA seqDB search
MFDYTHDHAQSQEILRLVLIELNALNLPPNPIFFTLFYERALKRDASLNKDIDDAINSDK
GLSVDTAQEIFDTHVLNGAIKEMSKAQSALLRVIRNVMMQMLNTGNEFSNYASSLGDFVR
KIDRTDSVQDIRMLTAEVIEDSRQLERTSKETSSQLNDAGEQITRLKEELEAARRDARTD
PLTGLANRRGLNELLLQRINLFLQEKTPFCVILADIDHFKRINDSYGHLVGDKILRFVAR
TLMANIKGQDSVIRFGGEEFAIVLPYTQYDGGIIVAQHLRQKIASSRLRLAESGRDLGGL
TISLGVAAVHTDDTPDSLLRRADDALLKAKAEGRDRVVGLPSEKPTGDVTEML
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtttgattacacgcacgatcacgcacaatctcaagagatcctccgtctggttcttatt
gaattaaatgcattaaatctgcccccaaaccccatattcttcaccctgttctacgagcgt
gcgctcaagcgagatgccagtcttaacaaagacatagatgatgccatcaacagcgataag
ggacttagcgttgatactgctcaggaaatcttcgacacgcatgttttgaacggtgcgatc
aaggaaatgagcaaagcgcaaagcgcactgctgcgcgtgattcgaaacgtcatgatgcaa
atgctcaacacaggcaatgagttttcgaactatgcgtcatccctcggtgactttgtgcgc
aaaattgataggacggattcggtacaggatattcggatgctcactgccgaggtgatcgaa
gattcacgccaacttgagcgcacgtctaaagaaacatcatcgcaattgaacgatgccgga
gagcagattacccgcctgaaagaagaactcgaagcagccagaagggatgcacgcaccgac
ccgctgaccggtctggcaaatcgccgcggtctcaatgaactgctgctgcaacgcatcaat
ctgttcttgcaggaaaagactcctttttgcgtgattctggcagacatcgaccacttcaaa
cgcatcaatgactcgtatggtcatctggttggcgacaagatattgcgcttcgtggcacgc
accttgatggccaacatcaagggtcaggacagcgtcatccgcttcggtggtgaggaattt
gcgatcgttctgccctatacgcaatacgatggggggattatcgttgctcaacatctgaga
cagaaaattgcttcatcgcgactccgactggccgaaagcgggcgtgatctcggcggactc
accatctccctcggagtggcagccgttcatacggatgacacccccgattcactcttgcgc
cgcgcggacgatgccttgctcaaagccaaggcagagggtcgtgatcgcgtggtgggcttg
ccttctgaaaaacccacgggcgacgtaactgaaatgctttga

DBGET integrated database retrieval system