KEGG   Halothiobacillus neapolitanus: Hneap_1290Help
Entry
Hneap_1290        CDS       T01104                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
hna  Halothiobacillus neapolitanus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1395345..1396406
Genome map
AA seq 353 aa AA seqDB search
MFDYTHDHAQSQEILRLVLIELNALNLPPNPIFFTLFYERALKRDASLNKDIDDAINSDK
GLSVDTAQEIFDTHVLNGAIKEMSKAQSALLRVIRNVMMQMLNTGNEFSNYASSLGDFVR
KIDRTDSVQDIRMLTAEVIEDSRQLERTSKETSSQLNDAGEQITRLKEELEAARRDARTD
PLTGLANRRGLNELLLQRINLFLQEKTPFCVILADIDHFKRINDSYGHLVGDKILRFVAR
TLMANIKGQDSVIRFGGEEFAIVLPYTQYDGGIIVAQHLRQKIASSRLRLAESGRDLGGL
TISLGVAAVHTDDTPDSLLRRADDALLKAKAEGRDRVVGLPSEKPTGDVTEML
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtttgattacacgcacgatcacgcacaatctcaagagatcctccgtctggttcttatt
gaattaaatgcattaaatctgcccccaaaccccatattcttcaccctgttctacgagcgt
gcgctcaagcgagatgccagtcttaacaaagacatagatgatgccatcaacagcgataag
ggacttagcgttgatactgctcaggaaatcttcgacacgcatgttttgaacggtgcgatc
aaggaaatgagcaaagcgcaaagcgcactgctgcgcgtgattcgaaacgtcatgatgcaa
atgctcaacacaggcaatgagttttcgaactatgcgtcatccctcggtgactttgtgcgc
aaaattgataggacggattcggtacaggatattcggatgctcactgccgaggtgatcgaa
gattcacgccaacttgagcgcacgtctaaagaaacatcatcgcaattgaacgatgccgga
gagcagattacccgcctgaaagaagaactcgaagcagccagaagggatgcacgcaccgac
ccgctgaccggtctggcaaatcgccgcggtctcaatgaactgctgctgcaacgcatcaat
ctgttcttgcaggaaaagactcctttttgcgtgattctggcagacatcgaccacttcaaa
cgcatcaatgactcgtatggtcatctggttggcgacaagatattgcgcttcgtggcacgc
accttgatggccaacatcaagggtcaggacagcgtcatccgcttcggtggtgaggaattt
gcgatcgttctgccctatacgcaatacgatggggggattatcgttgctcaacatctgaga
cagaaaattgcttcatcgcgactccgactggccgaaagcgggcgtgatctcggcggactc
accatctccctcggagtggcagccgttcatacggatgacacccccgattcactcttgcgc
cgcgcggacgatgccttgctcaaagccaaggcagagggtcgtgatcgcgtggtgggcttg
ccttctgaaaaacccacgggcgacgtaactgaaatgctttga

DBGET integrated database retrieval system