KEGG   Halothiobacillus neapolitanus: Hneap_1338Help
Entry
Hneap_1338        CDS       T01104                                 

Definition
phosphoserine aminotransferase (EC:2.6.1.52)
Orthology
K00831  
phosphoserine aminotransferase [EC:2.6.1.52]
Organism
hna  Halothiobacillus neapolitanus
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:hna01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hna01230]
Metabolism; Energy metabolism; Methane metabolism [PATH:hna00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hna00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:hna00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1449219..1450310)
Genome map
AA seq 363 aa AA seqDB search
MARVFNFGAGPATLPEDVLIQARDEMLDCDGTGMSVMEMSHRGKKFVAIAEQAEADLRQL
MSIPDNYKVLFLQGGASAQFAMIPMNLKAARGDGSADYLNTGHWSEKAIAEAKRFLNVNV
VADTKPSKYTLLPAADELKFNPNASYVHYTPNETIAGAEFGYIPESGDVPLVADMSSTIL
SRPVDVSKFGIIYAGAQKNIGPSGLTIAIVRDDLIGHAGADVPAMFDYKIHADNGSMYNT
PPTYAWYIAGLVFKRLLANGGLEQMKQINERKANKLYAAIDQSGGFYRNPVALNARSWMN
IPFILKDDALDKPFLAEADKAGLSALAGHRSVGGMRASIYNAMPEAGIDALIAFMHDFAQ
RHG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgagtatttaattttggcgcaggtcctgcgacgttacctgaagatgtgttgatt
caagcacgcgacgagatgttggattgcgatggcaccggtatgtccgtgatggagatgagc
catcgcggtaaaaaattcgttgccattgctgagcaggcagaagctgatcttcgtcagttg
atgtcgattccggacaattacaaagtgctgttcttgcagggcggggcatcggcccagttt
gccatgatccccatgaacctgaaagctgctcgtggtgatggttctgccgattatctgaac
accggtcactggtccgagaaagcaattgctgaagcgaagcgcttcctgaacgtcaacgtg
gttgccgataccaagccgagcaaatacaccctgttgcctgcagccgatgagctgaagttc
aacccgaacgcttcttatgttcactacacaccgaatgaaaccattgcgggcgccgagttc
ggttacattcctgaaagtggtgacgtgcctctggttgccgatatgtcatctacgatcctc
tcgcgtcctgtggacgtttctaagttcggcattatctatgccggtgcgcaaaaaaacatt
ggtccatccggtttaacgatcgccatcgttcgtgatgatctgatcggccatgcgggtgcc
gacgtgcctgccatgttcgactacaaaatccacgccgataacggttcgatgtacaacacg
ccgcccacctatgcctggtacatcgccggtctggtattcaagcgcctgctggcgaatggt
ggcttggagcaaatgaagcaaattaacgagcgcaaggccaacaagctctatgctgccatc
gatcagagtggcggtttctatcgcaatccggtggcgctcaatgcccgttcctggatgaat
atccccttcatcctcaaggatgatgcgctggataaaccattccttgccgaggctgacaag
gccggtctttctgcactggccggtcaccgttccgtcggtgggatgcgtgcaagtatttat
aacgccatgcctgaagccggtatcgacgcactgatcgcgtttatgcacgatttcgctcag
cgccacggttaa

DBGET integrated database retrieval system