KEGG   Halothiobacillus neapolitanus: Hneap_1338Help
Entry
Hneap_1338        CDS       T01104                                 

Definition
phosphoserine aminotransferase (EC:2.6.1.52)
Orthology
K00831  
phosphoserine aminotransferase [EC:2.6.1.52]
Organism
hna  Halothiobacillus neapolitanus
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hneap_1338
   01230 Biosynthesis of amino acids
    Hneap_1338
  Energy metabolism
   00680 Methane metabolism
    Hneap_1338
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hneap_1338
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hneap_1338
Enzymes [BR:hna01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.52  phosphoserine transaminase
     Hneap_1338
Amino acid related enzymes [BR:hna01007]
 Aminotransferase (transaminase)
  Class V
   Hneap_1338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1449219..1450310)
Genome map
AA seq 363 aa AA seqDB search
MARVFNFGAGPATLPEDVLIQARDEMLDCDGTGMSVMEMSHRGKKFVAIAEQAEADLRQL
MSIPDNYKVLFLQGGASAQFAMIPMNLKAARGDGSADYLNTGHWSEKAIAEAKRFLNVNV
VADTKPSKYTLLPAADELKFNPNASYVHYTPNETIAGAEFGYIPESGDVPLVADMSSTIL
SRPVDVSKFGIIYAGAQKNIGPSGLTIAIVRDDLIGHAGADVPAMFDYKIHADNGSMYNT
PPTYAWYIAGLVFKRLLANGGLEQMKQINERKANKLYAAIDQSGGFYRNPVALNARSWMN
IPFILKDDALDKPFLAEADKAGLSALAGHRSVGGMRASIYNAMPEAGIDALIAFMHDFAQ
RHG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgagtatttaattttggcgcaggtcctgcgacgttacctgaagatgtgttgatt
caagcacgcgacgagatgttggattgcgatggcaccggtatgtccgtgatggagatgagc
catcgcggtaaaaaattcgttgccattgctgagcaggcagaagctgatcttcgtcagttg
atgtcgattccggacaattacaaagtgctgttcttgcagggcggggcatcggcccagttt
gccatgatccccatgaacctgaaagctgctcgtggtgatggttctgccgattatctgaac
accggtcactggtccgagaaagcaattgctgaagcgaagcgcttcctgaacgtcaacgtg
gttgccgataccaagccgagcaaatacaccctgttgcctgcagccgatgagctgaagttc
aacccgaacgcttcttatgttcactacacaccgaatgaaaccattgcgggcgccgagttc
ggttacattcctgaaagtggtgacgtgcctctggttgccgatatgtcatctacgatcctc
tcgcgtcctgtggacgtttctaagttcggcattatctatgccggtgcgcaaaaaaacatt
ggtccatccggtttaacgatcgccatcgttcgtgatgatctgatcggccatgcgggtgcc
gacgtgcctgccatgttcgactacaaaatccacgccgataacggttcgatgtacaacacg
ccgcccacctatgcctggtacatcgccggtctggtattcaagcgcctgctggcgaatggt
ggcttggagcaaatgaagcaaattaacgagcgcaaggccaacaagctctatgctgccatc
gatcagagtggcggtttctatcgcaatccggtggcgctcaatgcccgttcctggatgaat
atccccttcatcctcaaggatgatgcgctggataaaccattccttgccgaggctgacaag
gccggtctttctgcactggccggtcaccgttccgtcggtgggatgcgtgcaagtatttat
aacgccatgcctgaagccggtatcgacgcactgatcgcgtttatgcacgatttcgctcag
cgccacggttaa

DBGET integrated database retrieval system