KEGG   Halothiobacillus neapolitanus: Hneap_1395Help
Entry
Hneap_1395        CDS       T01104                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hna  Halothiobacillus neapolitanus
Pathway
hna00260  Glycine, serine and threonine metabolism
hna00750  Vitamin B6 metabolism
hna01100  Metabolic pathways
hna01110  Biosynthesis of secondary metabolites
hna01120  Microbial metabolism in diverse environments
hna01230  Biosynthesis of amino acids
Module
hna_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hneap_1395
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hneap_1395
Enzymes [BR:hna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hneap_1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACX96229
JGI: Hneap_1395
UniProt: D0L0K6
Position
complement(1503142..1504329)
Genome map
AA seq 395 aa AA seqDB search
MSQAQPTAHRPSQRYDGLIDRYRDRLPVSDTTPIISLGEGNTPLIRLNNIPRVLGCSLDI
YVKYEGLNPTGSFKDRGMTMAVTKAVEAGSKAVICASTGNTSASAAAYAARAGITAFVLI
PDGKIAMGKLAQAMMYGATTLQIRGNFDDGMRLVKEVADHAPVTIVNSVNPFRLQGQKTA
AFEIIEELGRAPDFHCLPVGNAGNITAHWIGYCESSASHGDNLTESCAFCDGNCAFVKGA
ACTNRPKMIGYQASGSAPFIRGAMVDHPETLATAIRIGHPQSWDRAWKVMSESGGWFAEV
TDTEILAAQRMLTMHEGIFCEPASAASLAGLINDVKAGKIPEGSSVVLTLTGNGLKDPDT
AIAQCQGAQGDVEKARMLTIDANLDSVRSAILGFM
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaagctcaacccacagcacaccgcccatctcaacgttatgacggcttgatcgac
cgctatcgagatcgtcttccggtttccgataccaccccgatcatcagcctcggtgaaggc
aacacgcccctgattcgtttgaacaatatcccacgtgttctgggttgttcgcttgatatc
tacgtcaaatacgaaggtttgaatccaacgggttctttcaaggatcgcggcatgaccatg
gcggttaccaaagcggttgaagccggttccaaagcggtcatttgcgcctcaaccggcaat
acatcggcttctgccgcggcctatgccgcccgtgcaggcatcacggcattcgtcctgatc
cccgacggcaagatcgccatgggtaagctggcacaggcgatgatgtacggtgcgaccaca
ttgcagattcgtggcaatttcgatgatgggatgcgtctggtcaaggaagtcgcagaccat
gcgccggtcaccatcgtgaactcggtcaacccgttccgcctgcaaggccagaagacggcc
gcattcgaaattattgaagagctcggtcgtgcgccggatttccactgcctgcctgtgggt
aatgccggcaacatcacggcacattggatcggttactgcgaaagctctgcatcgcacggt
gacaatctgacggaatcctgcgcgttctgcgatggcaactgcgcatttgtcaaaggcgct
gcctgtaccaatcggccgaagatgatcggttaccaggcttcgggttccgctccattcatt
cgcggcgcaatggtcgatcatccggaaacccttgccaccgcaattcgtatcggacatccg
caaagctgggatcgtgcatggaaggtcatgagcgagtccggcggctggtttgctgaagtc
accgacaccgaaattctggctgcacagcgcatgctgaccatgcatgaagggattttctgc
gaaccggcttctgcggcttcgctggcgggtctgatcaatgatgtcaaggcagggaagatc
cccgaaggttcaagcgtagtcctgactttgaccggcaacggcctcaaggatccggacacg
gccattgctcaatgtcagggtgcgcagggcgatgtggaaaaagcccggatgctgaccatt
gatgccaatctggattcagttcgcagcgcgattctcggctttatgtaa

DBGET integrated database retrieval system