KEGG   Halothiobacillus neapolitanus: Hneap_1398Help
Entry
Hneap_1398        CDS       T01104                                 

Definition
(GenBank) glycoside hydrolase family 3 domain protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hna  Halothiobacillus neapolitanus
Pathway
hna00520  Amino sugar and nucleotide sugar metabolism
hna01100  Metabolic pathways
hna01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Hneap_1398
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Hneap_1398
Enzymes [BR:hna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Hneap_1398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Polyoma_lg_T_C
Motif
Other DBs
NCBI-ProteinID: ACX96232
JGI: Hneap_1398
UniProt: D0L0K9
Position
complement(1505825..1506913)
Genome map
AA seq 362 aa AA seqDB search
MTALGPLMVDVAGLTLTDAERTRLMNPAVGGVILFARNFSSTEQLTALTAEIRALRHPHL
LIAVDQEGGRVQRFRDDGFIHLPPMGRLGALFKHDRQAGLEAAKSLGWLMAVQLRMAGVD
LSFAPVLDLDRGVSGVIGDRAFSRDPASIIALAVAWISGMKEAGMAAVGKHFPGHGSIAE
DSHIAHPVDHRALSTIERDDLRPFVAMIERFIPALMMAHVVYPKIDALPAGFSKVWVQDL
LRKRWQYQGAVFTDDLTMAAASVAGDIGARVDAALAAGCDMALICNHPQWVDQLLTHRKF
TADPLREVRLAHLMGHGPVPSPNRFLHDHRTATAKAWVERLQNASFGDERAAAEDGWFLN
EE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgactgctttgggcccgttgatggtggacgtcgccggtttgacgctgacggatgcggag
cgcacgcgcctgatgaaccccgctgtgggtggtgtgattctatttgcccgcaacttttcc
tcgactgaacaactgacagcgctgacagccgaaattcgcgccttgcgccacccgcaccta
ttgattgcggtcgatcaggaaggcgggcgtgtccagcggttccgggatgatggttttatc
cacctgccgccgatggggcggctcggcgccttgtttaaacatgatcgtcaagcgggcttg
gaagctgccaaaagtctgggctggttgatggccgtacaactgcgcatggcgggcgtggat
ttgagttttgcgccggtgctggatctggatcgcggtgtcagtggcgtgattggcgaccgt
gctttttcccgtgatcccgcttcgatcattgcgttggctgtcgcctggatttctggcatg
aaggaagcgggtatggctgccgttggcaagcattttcccggtcatggctctattgctgaa
gattcgcatattgcccatccggtcgaccatcgggctttgtccacgatcgagcgcgatgac
ctcagaccttttgttgccatgatcgagcgttttatacccgccctgatgatggcgcatgtg
gtttatcctaaaatcgatgcattgcccgcgggtttttccaaggtctgggtgcaggatctc
ttgcgcaaacgttggcagtatcagggcgccgtgtttaccgacgacctcaccatggccgct
gcttccgtcgccggtgacattggtgcgcgcgtggatgcggcgctggccgccggttgcgat
atggcattgatctgcaatcatccacaatgggttgatcaattgttgacccaccgaaaattt
accgccgatcccctgcgcgaggtgcgtttggctcatctcatggggcacggtccggtccca
tcgcccaatcgttttttgcacgaccaccgcacggccacggcaaaagcctgggttgagcga
ctccagaatgcgtcattcggagatgagcgggcggccgccgaggacggttggtttttgaac
gaggagtaa

DBGET integrated database retrieval system