KEGG   Halothiobacillus neapolitanus: Hneap_1398Help
Entry
Hneap_1398        CDS       T01104                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hna  Halothiobacillus neapolitanus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Hneap_1398
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Hneap_1398
Enzymes [BR:hna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Hneap_1398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1505825..1506913)
Genome map
AA seq 362 aa AA seqDB search
MTALGPLMVDVAGLTLTDAERTRLMNPAVGGVILFARNFSSTEQLTALTAEIRALRHPHL
LIAVDQEGGRVQRFRDDGFIHLPPMGRLGALFKHDRQAGLEAAKSLGWLMAVQLRMAGVD
LSFAPVLDLDRGVSGVIGDRAFSRDPASIIALAVAWISGMKEAGMAAVGKHFPGHGSIAE
DSHIAHPVDHRALSTIERDDLRPFVAMIERFIPALMMAHVVYPKIDALPAGFSKVWVQDL
LRKRWQYQGAVFTDDLTMAAASVAGDIGARVDAALAAGCDMALICNHPQWVDQLLTHRKF
TADPLREVRLAHLMGHGPVPSPNRFLHDHRTATAKAWVERLQNASFGDERAAAEDGWFLN
EE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgactgctttgggcccgttgatggtggacgtcgccggtttgacgctgacggatgcggag
cgcacgcgcctgatgaaccccgctgtgggtggtgtgattctatttgcccgcaacttttcc
tcgactgaacaactgacagcgctgacagccgaaattcgcgccttgcgccacccgcaccta
ttgattgcggtcgatcaggaaggcgggcgtgtccagcggttccgggatgatggttttatc
cacctgccgccgatggggcggctcggcgccttgtttaaacatgatcgtcaagcgggcttg
gaagctgccaaaagtctgggctggttgatggccgtacaactgcgcatggcgggcgtggat
ttgagttttgcgccggtgctggatctggatcgcggtgtcagtggcgtgattggcgaccgt
gctttttcccgtgatcccgcttcgatcattgcgttggctgtcgcctggatttctggcatg
aaggaagcgggtatggctgccgttggcaagcattttcccggtcatggctctattgctgaa
gattcgcatattgcccatccggtcgaccatcgggctttgtccacgatcgagcgcgatgac
ctcagaccttttgttgccatgatcgagcgttttatacccgccctgatgatggcgcatgtg
gtttatcctaaaatcgatgcattgcccgcgggtttttccaaggtctgggtgcaggatctc
ttgcgcaaacgttggcagtatcagggcgccgtgtttaccgacgacctcaccatggccgct
gcttccgtcgccggtgacattggtgcgcgcgtggatgcggcgctggccgccggttgcgat
atggcattgatctgcaatcatccacaatgggttgatcaattgttgacccaccgaaaattt
accgccgatcccctgcgcgaggtgcgtttggctcatctcatggggcacggtccggtccca
tcgcccaatcgttttttgcacgaccaccgcacggccacggcaaaagcctgggttgagcga
ctccagaatgcgtcattcggagatgagcgggcggccgccgaggacggttggtttttgaac
gaggagtaa

DBGET integrated database retrieval system