KEGG   Halothiobacillus neapolitanus: Hneap_1398Help
Entry
Hneap_1398        CDS       T01104                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hna  Halothiobacillus neapolitanus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hna00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:hna00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1505825..1506913)
Genome map
AA seq 362 aa AA seqDB search
MTALGPLMVDVAGLTLTDAERTRLMNPAVGGVILFARNFSSTEQLTALTAEIRALRHPHL
LIAVDQEGGRVQRFRDDGFIHLPPMGRLGALFKHDRQAGLEAAKSLGWLMAVQLRMAGVD
LSFAPVLDLDRGVSGVIGDRAFSRDPASIIALAVAWISGMKEAGMAAVGKHFPGHGSIAE
DSHIAHPVDHRALSTIERDDLRPFVAMIERFIPALMMAHVVYPKIDALPAGFSKVWVQDL
LRKRWQYQGAVFTDDLTMAAASVAGDIGARVDAALAAGCDMALICNHPQWVDQLLTHRKF
TADPLREVRLAHLMGHGPVPSPNRFLHDHRTATAKAWVERLQNASFGDERAAAEDGWFLN
EE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgactgctttgggcccgttgatggtggacgtcgccggtttgacgctgacggatgcggag
cgcacgcgcctgatgaaccccgctgtgggtggtgtgattctatttgcccgcaacttttcc
tcgactgaacaactgacagcgctgacagccgaaattcgcgccttgcgccacccgcaccta
ttgattgcggtcgatcaggaaggcgggcgtgtccagcggttccgggatgatggttttatc
cacctgccgccgatggggcggctcggcgccttgtttaaacatgatcgtcaagcgggcttg
gaagctgccaaaagtctgggctggttgatggccgtacaactgcgcatggcgggcgtggat
ttgagttttgcgccggtgctggatctggatcgcggtgtcagtggcgtgattggcgaccgt
gctttttcccgtgatcccgcttcgatcattgcgttggctgtcgcctggatttctggcatg
aaggaagcgggtatggctgccgttggcaagcattttcccggtcatggctctattgctgaa
gattcgcatattgcccatccggtcgaccatcgggctttgtccacgatcgagcgcgatgac
ctcagaccttttgttgccatgatcgagcgttttatacccgccctgatgatggcgcatgtg
gtttatcctaaaatcgatgcattgcccgcgggtttttccaaggtctgggtgcaggatctc
ttgcgcaaacgttggcagtatcagggcgccgtgtttaccgacgacctcaccatggccgct
gcttccgtcgccggtgacattggtgcgcgcgtggatgcggcgctggccgccggttgcgat
atggcattgatctgcaatcatccacaatgggttgatcaattgttgacccaccgaaaattt
accgccgatcccctgcgcgaggtgcgtttggctcatctcatggggcacggtccggtccca
tcgcccaatcgttttttgcacgaccaccgcacggccacggcaaaagcctgggttgagcga
ctccagaatgcgtcattcggagatgagcgggcggccgccgaggacggttggtttttgaac
gaggagtaa

DBGET integrated database retrieval system