KEGG   Halothiobacillus neapolitanus: Hneap_1448Help
Entry
Hneap_1448        CDS       T01104                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hna  Halothiobacillus neapolitanus
Pathway
hna00900  Terpenoid backbone biosynthesis
hna01100  Metabolic pathways
hna01110  Biosynthesis of secondary metabolites
hna01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Hneap_1448
Enzymes [BR:hna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Hneap_1448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACX96280
JGI: Hneap_1448
UniProt: D0L0Q7
Position
complement(1564359..1565564)
Genome map
AA seq 401 aa AA seqDB search
MKSVSIFGSTGSIGQSTLAVVRLHPKHYRVQSLVANAQVDVLWAQIQEFHPRTVGVADPA
AAARLRERIAEQIPDGALRPEIVDQPAQIAALAAEESVDVVVAAIVGVAGLASTWAAVRA
GKQVLLANKESLVAAGQIMMTAVAESGATLLPIDSEHNAIFQCLPVGEQPAKAVDKLILT
ASGGPFRTHPLERFSEITVDEACRHPNWSMGRKISVDSATMMNKGLEVIEASWLFGMPAS
RIDVIVHPQSVIHSMVQFADGSVLAQLGLPDMRTPIAHALAWPERIESGVAPLDFTSLNG
LHFHAPDCERFPCLRLAYAAIESGGNAPLVLNAANEVAVAAFLDGRIAFNDISRLIEAVM
NLVQSGTRTAAPESIEAVLDENEWARAMADAAVIRFENSRG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatctgtttcaattttcggctcaacggggagcatcggccagagcacattggccgtg
gttcgtctccacccaaagcattatcgggtgcaaagcttggtggcgaacgcgcaggttgat
gttttgtgggcgcagattcaggaatttcacccccgtacggttggtgtggccgatccggct
gccgcggctcgattgcgcgagcgaatcgcagagcaaattccagatggcgcactgcggcca
gagatcgttgaccagccagcgcaaattgcagcattggccgcagaagaatcggtcgatgtc
gttgtagctgccattgtcggtgtggctggtcttgcctcgacctgggctgcggtgcgtgca
ggcaagcaggtgttgcttgccaacaaggagtcactggtcgcggcgggtcaaatcatgatg
accgccgtcgccgagtccggtgcgacgcttctgcccatcgacagtgaacacaacgcgatt
ttccagtgcctccccgttggagagcaacctgccaaagcggttgataaactcattctgacg
gcatccggcgggccatttagaacgcatccccttgagcgattttcagagattacagttgat
gaagcttgtcgtcatccgaactggtcgatggggcgcaaaatctcggtggattcggccacg
atgatgaacaaagggcttgaggtcatcgaggcatcctggctgtttggcatgccggcgtcg
cggatcgatgtgatcgtgcatccgcaatccgtgatccactccatggtgcaattcgcagat
ggttcggtgctggcccaactgggcctgccggatatgcgcacacccatcgcgcatgcattg
gcctggccggaacgaattgaatcgggcgtagcgcccctagattttacttccctcaatggc
ttgcactttcatgcgcccgattgtgaacgttttccttgcttgcggcttgcttatgcggcg
attgaaagcggcggcaacgcaccattggtactgaatgccgccaatgaagttgccgttgcc
gcatttctggatggccgtatcgcattcaacgatatttcccggttgattgaggctgtcatg
aacttggttcaatccggaacccggacggccgcgcccgagtccatagaggcggtgttggac
gagaacgagtgggcacgtgcgatggcggatgcggctgtcattcgtttcgagaattcacgt
ggctga

DBGET integrated database retrieval system