KEGG   Halothiobacillus neapolitanus: Hneap_1501Help
Entry
Hneap_1501        CDS       T01104                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
hna  Halothiobacillus neapolitanus
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Hneap_1501
Enzymes [BR:hna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Hneap_1501
Transfer RNA biogenesis [BR:hna03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Hneap_1501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1624673..1625476
Genome map
AA seq 267 aa AA seqDB search
MKPSPPLLNNLVSIAQRAGDAIMAVYSTDFSVETKADESPLTRADQAAHELIVSELKKLA
PEIPILSEEDTDIPGRAEWGSGKYWLVDPLDGTKEFIKRNGEFTVNIALIEQGRAVMGVV
HAPALGVTYAASTNEGAFKLAEGSADQWQRIEVARHDGKTPWRVVGSRSHADDSLTEFMS
RLGECELVSMGSSLKLCLVAEGAADIYPRLGPTSLWDTAAAQCVVEAAGGKVIQLDGSPL
SYANTEQLLNPFFLVHGISKTNWPSLF
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaagccctcctctccttaacaatctagtcagcatcgcccagcgcgccggtgat
gcgattatggcggtgtattcaacagatttttctgttgaaactaaggccgatgaatcccct
cttacccgagccgatcaggccgcgcatgagttgatcgtttctgaactcaaaaagctcgcc
cctgagattccgatcctttcggaagaagatacggatattcctggtcgagcagaatggggt
tcgggtaagtattggttggttgacccattggatggcaccaaagaattcatcaagcgtaat
ggtgagttcactgtaaatattgcattgattgaacaaggccgtgcagtgatgggtgttgtt
catgcgcctgcgcttggcgtaacttatgcagccagcaccaatgaaggcgcatttaaattg
gctgagggctctgcggatcaatggcaacgtattgaagtcgcccgacacgatggaaaaaca
ccttggcgcgtggtgggcagccgttcacacgctgatgactcacttaccgaattcatgtcg
cgcttaggtgaatgtgagctggtttcgatgggcagctcgttgaaactctgtcttgttgcc
gagggcgctgccgatatttatccgcgccttggacctaccagcttatgggataccgccgcc
gcacaatgcgtggttgaagcagcgggtggcaaagtaattcaactcgatggcagtccattg
agttacgcaaacaccgaacaattgttgaatcctttttttctggtgcatggaatcagtaaa
acaaactggccatctttattttga

DBGET integrated database retrieval system