KEGG   Halothiobacillus neapolitanus: Hneap_1858Help
Entry
Hneap_1858        CDS       T01104                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hna  Halothiobacillus neapolitanus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hneap_1858
   01230 Biosynthesis of amino acids
    Hneap_1858
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hneap_1858
   00030 Pentose phosphate pathway
    Hneap_1858
   00051 Fructose and mannose metabolism
    Hneap_1858
   00052 Galactose metabolism
    Hneap_1858
  Energy metabolism
   00680 Methane metabolism
    Hneap_1858
Enzymes [BR:hna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Hneap_1858
Protein phosphatases and associated proteins [BR:hna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Hneap_1858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1992768..1994024)
Genome map
AA seq 418 aa AA seqDB search
MSHNVLYAQSGGVTAVINASACGVIETAQRHPEYFGKVFAARDGILGILREELYDLSGVS
PAEIAALRHTPGGAFGSCRADLGEPDTHPAQYERLLDVIQAHDIGTFIYNGGGGSMLTAA
KVARFARARNLDLTVIGVPKTIDNDLPMTDTSPGFGSAAKYIATSVREVARDLAAMSGTS
TKVFVLEVMGRHAGWLAAAAGLAFETDDPPLLLLFPERSFNPADFLAALQLRVQHYGCCI
VIVAEGLLCADGTFCAQEQTSSTFGHEQLGGMAPQIAAMSRGLGYKTHWAVSDYFQRSAR
HLASRVDVDQAYACGAAAITYAMAGQSDVMVAIERLSDEPYLWSLGAVPLDDVADVELPV
PPAYIRADGYGITDAARRYMQPLIQGEDLPPFRNGLPVFAQLNFELAVKRLPEWGGKP
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtcacacaacgttttgtatgcgcagtctggcggggttaccgcagtcatcaacgccagt
gcgtgcggggtgattgaaacggcgcagaggcaccccgagtacttcgggaaagtatttgcc
gcgcgtgatgggattctcggcattttgcgcgaggagctatatgacttgtcaggcgtgagc
ccggcggaaatcgcggcgttgcggcatactcccggtggcgcattcggttcttgtcgagcc
gatcttggtgagccggatacgcatcctgcgcagtatgagcggttgcttgatgtgatccaa
gcgcatgacattggcacctttatttataacggcgggggcggctcgatgttgactgcggcc
aaggtggcgcgcttcgcccgtgcccggaaccttgatctgaccgtcatcggcgtgcccaaa
accatcgataacgatctgccaatgaccgacacgagtcccgggtttggctcggcggcaaaa
tatatcgcgaccagtgttcgggaagtggcgcgcgatcttgctgcgatgtctggaacctcg
accaaggtctttgtgcttgaagtcatggggcgtcatgcaggctggctggctgcggcggcc
ggactggcattcgagacggacgatccacccttgttgcttctgtttccggagcggtctttt
aatcctgccgactttcttgcggccctgcagttacgtgttcagcactatggttgctgtatc
gttatcgtggcagaaggtttgctgtgcgctgacggaaccttctgtgcccaggagcaaacc
agctcgaccttcggccatgaacaactgggcggcatggcgccacagattgccgccatgagc
cgtgggcttgggtataaaactcattgggccgtttctgattattttcagcgttcggcgcgc
catcttgcttcacgggtggatgtggaccaggcctatgcctgcggggcggcagccatcacc
tatgccatggcgggtcagtcggatgtgatggtcgccattgaacggttgtcagacgaaccg
tatctctggtcgctcggcgcggtgccactcgatgatgtggccgatgtcgagttgccagtg
ccaccggcttatattcgagccgatggctacggtattaccgatgcggcgcggcgttatatg
caacctctcatccaaggtgaggatctgccgccgttcagaaatggcttgcctgtgtttgcg
cagttgaactttgaactggcagttaagcgactgcccgagtggggcgggaagccgtga

DBGET integrated database retrieval system