KEGG   Halothiobacillus neapolitanus: Hneap_1858Help
Entry
Hneap_1858        CDS       T01104                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
hna  Halothiobacillus neapolitanus
Pathway
hna00010  Glycolysis / Gluconeogenesis
hna00030  Pentose phosphate pathway
hna00051  Fructose and mannose metabolism
hna00052  Galactose metabolism
hna00680  Methane metabolism
hna01100  Metabolic pathways
hna01110  Biosynthesis of secondary metabolites
hna01120  Microbial metabolism in diverse environments
hna01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hneap_1858
   00030 Pentose phosphate pathway
    Hneap_1858
   00051 Fructose and mannose metabolism
    Hneap_1858
   00052 Galactose metabolism
    Hneap_1858
  Energy metabolism
   00680 Methane metabolism
    Hneap_1858
Enzymes [BR:hna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Hneap_1858
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Hneap_1858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACX96680
JGI: Hneap_1858
UniProt: D0L1V7
Position
complement(1992768..1994024)
Genome map
AA seq 418 aa AA seqDB search
MSHNVLYAQSGGVTAVINASACGVIETAQRHPEYFGKVFAARDGILGILREELYDLSGVS
PAEIAALRHTPGGAFGSCRADLGEPDTHPAQYERLLDVIQAHDIGTFIYNGGGGSMLTAA
KVARFARARNLDLTVIGVPKTIDNDLPMTDTSPGFGSAAKYIATSVREVARDLAAMSGTS
TKVFVLEVMGRHAGWLAAAAGLAFETDDPPLLLLFPERSFNPADFLAALQLRVQHYGCCI
VIVAEGLLCADGTFCAQEQTSSTFGHEQLGGMAPQIAAMSRGLGYKTHWAVSDYFQRSAR
HLASRVDVDQAYACGAAAITYAMAGQSDVMVAIERLSDEPYLWSLGAVPLDDVADVELPV
PPAYIRADGYGITDAARRYMQPLIQGEDLPPFRNGLPVFAQLNFELAVKRLPEWGGKP
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtcacacaacgttttgtatgcgcagtctggcggggttaccgcagtcatcaacgccagt
gcgtgcggggtgattgaaacggcgcagaggcaccccgagtacttcgggaaagtatttgcc
gcgcgtgatgggattctcggcattttgcgcgaggagctatatgacttgtcaggcgtgagc
ccggcggaaatcgcggcgttgcggcatactcccggtggcgcattcggttcttgtcgagcc
gatcttggtgagccggatacgcatcctgcgcagtatgagcggttgcttgatgtgatccaa
gcgcatgacattggcacctttatttataacggcgggggcggctcgatgttgactgcggcc
aaggtggcgcgcttcgcccgtgcccggaaccttgatctgaccgtcatcggcgtgcccaaa
accatcgataacgatctgccaatgaccgacacgagtcccgggtttggctcggcggcaaaa
tatatcgcgaccagtgttcgggaagtggcgcgcgatcttgctgcgatgtctggaacctcg
accaaggtctttgtgcttgaagtcatggggcgtcatgcaggctggctggctgcggcggcc
ggactggcattcgagacggacgatccacccttgttgcttctgtttccggagcggtctttt
aatcctgccgactttcttgcggccctgcagttacgtgttcagcactatggttgctgtatc
gttatcgtggcagaaggtttgctgtgcgctgacggaaccttctgtgcccaggagcaaacc
agctcgaccttcggccatgaacaactgggcggcatggcgccacagattgccgccatgagc
cgtgggcttgggtataaaactcattgggccgtttctgattattttcagcgttcggcgcgc
catcttgcttcacgggtggatgtggaccaggcctatgcctgcggggcggcagccatcacc
tatgccatggcgggtcagtcggatgtgatggtcgccattgaacggttgtcagacgaaccg
tatctctggtcgctcggcgcggtgccactcgatgatgtggccgatgtcgagttgccagtg
ccaccggcttatattcgagccgatggctacggtattaccgatgcggcgcggcgttatatg
caacctctcatccaaggtgaggatctgccgccgttcagaaatggcttgcctgtgtttgcg
cagttgaactttgaactggcagttaagcgactgcccgagtggggcgggaagccgtga

DBGET integrated database retrieval system