KEGG   Halothiobacillus neapolitanus: Hneap_1966Help
Entry
Hneap_1966        CDS       T01104                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hna  Halothiobacillus neapolitanus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hneap_1966
   01230 Biosynthesis of amino acids
    Hneap_1966
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hneap_1966
   00051 Fructose and mannose metabolism
    Hneap_1966
   00562 Inositol phosphate metabolism
    Hneap_1966
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Hneap_1966
Enzymes [BR:hna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Hneap_1966
Exosome [BR:hna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Hneap_1966
  Exosomal proteins of bladder cancer cells
   Hneap_1966
  Exosomal proteins of melanoma cells
   Hneap_1966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2101217..2101987)
Genome map
AA seq 256 aa AA seqDB search
MRKPIVLGNWKLNGSTASSEALVAGILAGVTGLDAIDVGVCPPFVLIPQTVRQAAHTDLK
VGAQDCSEYVEGAYTAEVSADMLRDVGCHHVLIGHSERRALFGEQNDVIARKVGRALAAG
LMPVLCVGETLEERQSGHMDEVVCSQVQAVINEVGVAAFDRIVIAYEPVWAIGTGLTASP
EQAQAMHATIRGLIAGQNASVARAVRIQYGGSVKPDNAAELFSQPDIDGGLIGGASLKAE
DFMIICRAAADSLGTV
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagccaatcgtactcggaaactggaagcttaatggctctacggcctcttcggag
gcgttggtggcgggcattcttgccggggtaacgggattggatgcgatcgacgtaggggtt
tgccctccgttcgttcttattccgcaaacggtgcgccaagcagcgcatacggatttgaag
gttggtgctcaggattgctcggagtatgtcgagggtgcctacacggccgaagtctcggca
gacatgctgcgtgatgtaggttgtcaccatgtgctgatcggtcactccgagcgccgggca
cttttcggtgagcagaatgacgtgattgctcgcaaagtcgggcgcgctctggcagccggt
ctcatgcccgttctgtgtgtgggcgaaactttggaagagcgtcaatccgggcatatggat
gaagtcgtctgctctcaagtgcaggcggtcattaacgaggttggtgtcgctgcatttgat
cgaatcgttatcgcgtatgagcctgtctgggcgatcgggaccggtttgactgcttcgccc
gagcaggcgcaggcaatgcacgctacgattcgtggtctgattgcagggcaaaacgcatcg
gtcgcgcgtgccgtgcgcattcagtacggtggatcggtgaagccggataacgctgccgaa
ctgttttcccagcctgacattgatggcggcttgattggcggcgcatccttgaaggccgaa
gattttatgattatttgtcgtgctgcggccgactcgcttggaaccgtgtga

DBGET integrated database retrieval system