KEGG   Halothiobacillus neapolitanus: Hneap_1988Help
Entry
Hneap_1988        CDS       T01104                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hna  Halothiobacillus neapolitanus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hneap_1988
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hneap_1988
   00640 Propanoate metabolism
    Hneap_1988
   00660 C5-Branched dibasic acid metabolism
    Hneap_1988
Enzymes [BR:hna01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Hneap_1988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2130303..2131508
Genome map
AA seq 401 aa AA seqDB search
MNLHEYQAKALLTGFSVPVATGLVINHPAQAADDQLPPSDDQRWVLKAQIHSGARGKAGG
VLIADSPDDIRAKAAELLGKTLVTHQTGPTGLPVHQLLIEPASAITQELYLAMTIDRQRQ
RVVVIASQHGGMDIEQVSAEHPDAIFRLYINPTVGLMGYQARRLGFALGLSDTALKQFPA
LLRGVYDAFIKNDADLIEINPLAVTADNTLLAVDAKIAIDGNAAYRQKALFATRDVTQED
PTEVAAQASGLNYISLTGEIACMVNGAGLAMATMDLIQSAGGSPANFLDVGGGTSTEKVA
AAFKLILANPRVKAILVNIFGGIVRCDLIANGIIAAAHEVGLTLPTVVRLEGTNAAEGRR
LLAESGLNLIAENDLAAAAARVVALSNTDSANKDSANGADA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacacgaatatcaagccaaagccctgttgaccggcttctctgtaccggtcgcg
acgggactggttatcaaccatcccgcacaggcagccgatgaccaactcccacctagcgac
gatcaacgctgggtgctcaaggctcagattcacagcggtgcccgcggcaaggcaggcggc
gtactgattgccgattcgcccgatgacattcgtgccaaagcggccgagttgctaggcaaa
accctggtcacgcaccagaccgggccaacgggtcttcccgtgcatcaactgctgatcgag
ccggcgagcgccatcacgcaggaactgtatctggccatgacgatcgaccgccaacgccag
cgtgtcgtggttattgcttcacaacatggcggcatggacatcgaacaggtttccgccgaa
caccccgatgcgattttccgcctgtacatcaacccgaccgtgggtttgatgggctatcag
gcccgtcggctcggcttcgcgcttggtttgagcgataccgcattgaagcagttccccgca
ctcttgcgcggcgtatacgatgccttcatcaagaatgacgccgatctgatcgagatcaac
ccgctggccgttaccgccgacaacaccctgttggcggtcgatgccaaaattgccatcgat
ggcaatgcggcgtatcggcaaaaagctctgttcgcgacgcgcgatgtcactcaagaggat
ccgaccgaagtcgccgctcaggccagtggtctgaactacatttcgctcaccggagaaatt
gcctgcatggtgaatggcgcgggtctggcgatggcgacaatggatttgatccagtcggcg
ggcggcagtccggccaatttcctcgatgttggcggtggcacgtcgaccgaaaaagtcgcg
gccgcattcaagctgattctggccaacccgcgcgtcaaggcgattttggtcaacattttc
ggcgggatcgtgcgatgcgatctcattgcaaatggcatcatcgcggccgcgcatgaagtc
gggctgaccctgccgaccgtggttcgcctggaaggcacgaacgcggccgaaggccgacgc
ctgctggctgaatccggcttgaacctgattgcggaaaatgatctggccgccgccgccgca
agggtggtcgccctatcaaatacagattcggccaataaagattcggccaacggagcggac
gcatga

DBGET integrated database retrieval system