KEGG   Halothiobacillus neapolitanus: Hneap_1988Help
Entry
Hneap_1988        CDS       T01104                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hna  Halothiobacillus neapolitanus
Pathway
hna00020  Citrate cycle (TCA cycle)
hna00640  Propanoate metabolism
hna00660  C5-Branched dibasic acid metabolism
hna01100  Metabolic pathways
hna01110  Biosynthesis of secondary metabolites
hna01120  Microbial metabolism in diverse environments
hna01130  Biosynthesis of antibiotics
hna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hneap_1988
   00640 Propanoate metabolism
    Hneap_1988
   00660 C5-Branched dibasic acid metabolism
    Hneap_1988
Enzymes [BR:hna01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Hneap_1988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ACX96810
JGI: Hneap_1988
UniProt: D0KVI0
Position
2130303..2131508
Genome map
AA seq 401 aa AA seqDB search
MNLHEYQAKALLTGFSVPVATGLVINHPAQAADDQLPPSDDQRWVLKAQIHSGARGKAGG
VLIADSPDDIRAKAAELLGKTLVTHQTGPTGLPVHQLLIEPASAITQELYLAMTIDRQRQ
RVVVIASQHGGMDIEQVSAEHPDAIFRLYINPTVGLMGYQARRLGFALGLSDTALKQFPA
LLRGVYDAFIKNDADLIEINPLAVTADNTLLAVDAKIAIDGNAAYRQKALFATRDVTQED
PTEVAAQASGLNYISLTGEIACMVNGAGLAMATMDLIQSAGGSPANFLDVGGGTSTEKVA
AAFKLILANPRVKAILVNIFGGIVRCDLIANGIIAAAHEVGLTLPTVVRLEGTNAAEGRR
LLAESGLNLIAENDLAAAAARVVALSNTDSANKDSANGADA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacacgaatatcaagccaaagccctgttgaccggcttctctgtaccggtcgcg
acgggactggttatcaaccatcccgcacaggcagccgatgaccaactcccacctagcgac
gatcaacgctgggtgctcaaggctcagattcacagcggtgcccgcggcaaggcaggcggc
gtactgattgccgattcgcccgatgacattcgtgccaaagcggccgagttgctaggcaaa
accctggtcacgcaccagaccgggccaacgggtcttcccgtgcatcaactgctgatcgag
ccggcgagcgccatcacgcaggaactgtatctggccatgacgatcgaccgccaacgccag
cgtgtcgtggttattgcttcacaacatggcggcatggacatcgaacaggtttccgccgaa
caccccgatgcgattttccgcctgtacatcaacccgaccgtgggtttgatgggctatcag
gcccgtcggctcggcttcgcgcttggtttgagcgataccgcattgaagcagttccccgca
ctcttgcgcggcgtatacgatgccttcatcaagaatgacgccgatctgatcgagatcaac
ccgctggccgttaccgccgacaacaccctgttggcggtcgatgccaaaattgccatcgat
ggcaatgcggcgtatcggcaaaaagctctgttcgcgacgcgcgatgtcactcaagaggat
ccgaccgaagtcgccgctcaggccagtggtctgaactacatttcgctcaccggagaaatt
gcctgcatggtgaatggcgcgggtctggcgatggcgacaatggatttgatccagtcggcg
ggcggcagtccggccaatttcctcgatgttggcggtggcacgtcgaccgaaaaagtcgcg
gccgcattcaagctgattctggccaacccgcgcgtcaaggcgattttggtcaacattttc
ggcgggatcgtgcgatgcgatctcattgcaaatggcatcatcgcggccgcgcatgaagtc
gggctgaccctgccgaccgtggttcgcctggaaggcacgaacgcggccgaaggccgacgc
ctgctggctgaatccggcttgaacctgattgcggaaaatgatctggccgccgccgccgca
agggtggtcgccctatcaaatacagattcggccaataaagattcggccaacggagcggac
gcatga

DBGET integrated database retrieval system