KEGG   Halothiobacillus neapolitanus: Hneap_2023Help
Entry
Hneap_2023        CDS       T01104                                 

Definition
(RefSeq) formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
  KO
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
hna  Halothiobacillus neapolitanus
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:hna00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Hneap_2023
Enzymes [BR:hna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Hneap_2023
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Hneap_2023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2167684..2168529
Genome map
AA seq 281 aa AA seqDB search
MPELPEVETTRRGLEPHLLGQRITSATVFDSRLRWRVRDDLAAWLEGRLIIAVSRRSKYL
LLHFENGERLLIHLGMSGSLRIVTPDIPRRKHDHVEICINSSKNLRFHDPRRFGALLTDH
EQAPHIRLQNLGPEPLSDAFDTHYLGTQLHKRKQAIKPCLMNAAIVVGVGNIYANEVLFL
SGIHPATPAHTLDHNQINLLVTAIKNVLARAIEQGGTTLRDFVREDGQPGYFKQTLNVYD
RADQPCRVCSTPIVKTVQAQRATYYCPVCQPPLADRSGQRT
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattacccgaagtcgaaaccacccgccgagggctcgaaccccatctgctcggg
cagcggattacgagtgcaaccgtattcgactcccgactgcgctggcgcgtgcgtgatgat
cttgcagcatggctcgaaggtcgcctaatcatcgccgtctcacggcgatcgaaataccta
ttactgcactttgaaaacggtgagcgcctactgattcatctgggtatgtccggcagtctg
cgtatcgtgacgcccgatataccgcgcagaaaacatgaccacgtcgagatctgtatcaat
agcagtaagaatctgcgtttccacgatccgcgacgattcggcgcgctgttgaccgatcat
gaacaagccccccacatccgactgcaaaatctaggccccgagccactctctgacgcattc
gacacccattatctcggcactcagctacacaagcgcaaacaagccatcaaaccctgcctg
atgaatgccgcgattgtcgttggcgtcgggaacatctacgcgaacgaggtgctctttttg
tccggcatccaccccgcaacaccggcccacacgctcgatcacaaccaaatcaatcttctc
gttacggccatcaagaatgtactggcccgagccattgaacagggcggcaccacgctcaga
gattttgtccgcgaagacgggcaaccgggctatttcaaacaaactctgaacgtttatgac
cgggcggatcaaccctgtcgggtttgcagcaccccaatcgttaaaaccgtgcaggcgcag
cgcgccacttattactgccctgtgtgccagccgccattggcagatcgctccggccagcgc
acttga

DBGET integrated database retrieval system