KEGG   Halothiobacillus neapolitanus: Hneap_2037Help
Entry
Hneap_2037        CDS       T01104                                 

Definition
disulfide bond isomerase, DsbC/G-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hna  Halothiobacillus neapolitanus
Brite
Enzymes [BR:hna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Hneap_2037
Secretion system [BR:hna02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Hneap_2037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2181127..2181894)
Genome map
AA seq 255 aa AA seqDB search
MSFSRSVTFRALFFGAMATSTVMASVSMARADQASDEQTIRKELAQSMAQLPIDSVAPSP
IKGIYQIVSKGQIAYVTADGHYLFAGNLLDLKNQVNLTEKVRDQERVALLKTVPTDHKVI
FAADGAKKGTVTILTDPTCPFCEKLHREIPALQKAGIEVQTILTPRAGKGSPGYVESSQI
MCSKDKIKNVDIAMARKPLSGDACKDSMIDANMALAEQLGMSGTPYIILPDGSAVPGYRP
ASMLIPVITEQTTTE
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtttttcccgttccgtgactttccgcgctctgttttttggggcgatggccacctcg
accgtcatggcatccgtctcgatggcgcgggcagatcaggccagcgatgagcagacgatc
cgcaaggagttggctcaatcgatggcccaactgccaatcgacagtgtggcacccagccca
atcaaagggatctaccagatcgtctccaaagggcagattgcctacgttactgccgacgga
cactacctgttcgccggtaatctgctggatctcaagaatcaggtcaatctgaccgaaaaa
gtccgtgatcaggagcgcgtcgcgctgcttaaaaccgtgccgacagaccacaaggtcatt
tttgcggccgacggcgccaaaaagggtacggtcaccattctgaccgatccgacctgcccg
ttctgcgagaaattgcatcgtgaaattccggccctgcaaaaagccggtatcgaagttcaa
accatcctgacgccacgtgcgggcaagggctcgcctggctatgtcgagtcctcgcagatc
atgtgcagcaaggacaagatcaagaacgtggatatcgcgatggcgcgcaagcccctgtcg
ggtgatgcctgcaaggacagcatgatcgacgcgaacatggcattggcagagcagttgggc
atgagtggtacgccctatataatcctgccggacggcagcgcggtgccgggttatcgtccg
gcgtcgatgttgattcccgtgattaccgaacaaactactaccgagtaa

DBGET integrated database retrieval system