KEGG   Halothiobacillus neapolitanus: Hneap_2048Help
Entry
Hneap_2048        CDS       T01104                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hna  Halothiobacillus neapolitanus
Pathway
hna00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hna01100  Metabolic pathways
hna01110  Biosynthesis of secondary metabolites
hna01130  Biosynthesis of antibiotics
hna01230  Biosynthesis of amino acids
Module
hna_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hneap_2048
Enzymes [BR:hna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Hneap_2048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACX96869
JGI: Hneap_2048
UniProt: D0KVN9
Position
complement(2191507..2192316)
Genome map
AA seq 269 aa AA seqDB search
MTDTPDILKKIIARKWAEVAERSALLPVTELALLAREADAPRGFVAALRRKIAAGQPAVI
AEVKKASPSRGVLRDPFHPAEIARQYEAGGAACLSVLTDHDFFQGNEDYLREARAACRLP
VLRKDFMVDEYQVVEARALGADCILLIVAALSDLEMGALHQQATDLGMDVLVEVHDANEL
QRALALGIDMVGINNRDLRTFDVTLDTTLGLLSQIPPDILVVTESGILSPADVERMRKND
VHAFLIGEAFMRADDPGAALHHLFGGTSK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgactgatacacccgacattctgaaaaaaatcatcgccagaaaatgggccgaagtggcc
gagcgcagtgcgcttctcccggtgacagagctggcactgttggctcgtgaggcggatgcg
ccgcgcggttttgtcgcggcattgcgccgaaaaattgctgcggggcaaccggcagttatc
gccgaagtgaaaaaagcctcccccagccggggcgtgctgcgcgacccgttccacccagcc
gaaattgctcggcaatacgaagcagggggtgccgcctgtttgtccgtgctgaccgatcat
gatttttttcaaggcaatgaggactacctgcgcgaagcccgcgcggcctgccggttgccg
gtgctgcgaaaggacttcatggtcgatgaatatcaggtggtcgaagcgcgtgcgctgggt
gccgattgcattttgctgatcgttgccgcattgagcgatctcgaaatgggcgccttgcat
cagcaagccactgatctgggcatggatgtgctggttgaagtgcatgacgccaacgagctg
cagcgtgctctggctctgggtattgacatggtgggcatcaataaccgcgatctgcgcacg
tttgacgtcacgctcgataccacgctcggattgttgagccagattccaccggacattctg
gtcgtcaccgaaagcggcatcctctcaccagccgatgtcgagcggatgcggaagaacgat
gtgcatgctttcctgatcggcgaagcattcatgcgcgccgacgatccgggcgcggcgctg
caccatctttttggaggaacaagcaaatga

DBGET integrated database retrieval system