KEGG   Halothiobacillus neapolitanus: Hneap_2118Help
Entry
Hneap_2118        CDS       T01104                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
hna  Halothiobacillus neapolitanus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hna00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:hna00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2274262..2275017
Genome map
AA seq 251 aa AA seqDB search
MNARRTLLITGVSRRIGAHLAAHYLARGDRVIGTYRQETDELAKLREQGLHAVQIDLTDT
AALAGLIDDIAAYTDRLDAIVHNASIWPSDADCDADCTRQPPLISQLYQLHVTTPVQLTL
ALQHRLPAPIKDGRATRTVVFLTDTKVSAGSDGHLHYLASKAAAQSAMRSLAISLAPHTR
ANAIAPGLILFHEQDSAEKRANRLAKNLLPFEPGAEVIAQSMDYLLDCSAVTGITLPVDC
GLHLLNPSARD
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctcgccgaacgcttcttattactggcgtcagtcgccgcattggggcgcatctg
gccgcccactatctggcgcgtggcgatcgggttatcggcacgtatcggcaagaaacagac
gagttggctaagctacgcgaacagggcctgcacgctgttcagatcgacttgaccgatacg
gccgccctagccgggttgattgacgacatcgccgcctacaccgatcggctcgatgcgatt
gtgcataatgcatcaatctggcccagtgatgcagattgtgatgcagactgcacccgacag
ccgccactgatctcgcagctctaccaattgcatgtcaccacacccgttcagctgaccctg
gcgctccagcatcgtttgcccgcaccgattaaggacggacgcgccacacgaacggtggtg
tttctcaccgacaccaaggtatcagcgggcagcgatggccatctgcattacctcgcctcc
aaagccgcagcacaaagcgccatgcgttcactggcgatcagccttgccccacacacccga
gccaacgccattgcgccgggtttaatcctgtttcatgaacaggattccgccgaaaaacgt
gctaaccggcttgccaagaacctgttgccgttcgaaccaggagccgaagtcatcgcccaa
agtatggattaccttttggattgctccgccgtcaccggcatcaccctaccggtcgactgc
gggctgcacctgctcaacccctcggcacgggattaa

DBGET integrated database retrieval system