KEGG   Halothiobacillus neapolitanus: Hneap_2162Help
Entry
Hneap_2162        CDS       T01104                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hna  Halothiobacillus neapolitanus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hna00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2320524..2321294
Genome map
AA seq 256 aa AA seqDB search
MTSGSPLTIGLTRPDGANDELAKAISSLLPDATLLNWPLLTFAPIPERQKALSAMARITA
GDWAIFVSPRAVRFAHDLHDLTALPGLHWAAVGDTTTAAIQSLFSDPPQVHRPSSTQDSE
GLLASLPIEAMRGHTVWLFRGQTGRETLADTLRQNGITVIPVPVYRRNCTRRPAHLSALP
STWVITAPESLRCLRQLADTLESAEDRARLLHCNLVVINARTEARARSLGFTGAIVRAEA
PDDAALARACVVFKQD
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcggctcgccactcaccatcggattgacccgccccgatggtgccaatgacgaa
ctggccaaagccatatcgagcctgttgccagatgcaaccttgctcaactggccactgtta
actttcgcgccgatacccgagcgacaaaaagcactatctgccatggctcgcattaccgca
ggtgactgggccatcttcgtcagcccacgtgccgttcgtttcgcccatgatctgcacgat
ctcaccgcattacccggtcttcattgggccgccgtgggcgatacaacgactgccgccatc
caatctctattttcagacccgcctcaggttcatcgcccgtccagcactcaggattccgaa
ggtctgctggccagcctgccgatcgaggcgatgcgtggacacaccgtctggctgttccgt
ggccagaccggacgcgaaacgctggcagacaccctgaggcagaacggcattaccgtcatc
cccgttccggtgtaccgccgaaactgcacccgtcggccggcgcatttgtcggctttaccc
tcgacctgggtgatcaccgcacccgaatcgctccgatgcctgcgccagctggccgacacc
ttggagtctgccgaagatcgcgcgagactgttacactgcaacctcgttgtcatcaacgca
cgaacagaagcccgcgcgcggtcgctgggctttacaggagccatcgtgcgtgccgaagcc
cccgatgatgcggccttggcgcgtgcttgcgtcgttttcaagcaggattag

DBGET integrated database retrieval system