KEGG   Halothiobacillus neapolitanus: Hneap_2165Help
Entry
Hneap_2165        CDS       T01104                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
hna  Halothiobacillus neapolitanus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2323808..2325190)
Genome map
AA seq 460 aa AA seqDB search
MNDSAKTDYRAKYEQLLDEFSSLETSEQLQQSLLRSLLNRVLFAVDKAYPTLAKESQALR
DLMRQIGDGPLPVARIQPGIEHLAEAIRAIEAGDPTPDREEALSNDEAAERVDVRDFLPL
LLERVAFTESMEGRREKLLAILNNPKDKTLNSILIDRAATLINDMRRALENEKNELTEFL
RQLTEALSEIDQHTLANLGDIETQRKVQEALGNAVTEQVSHIDRTVSDATDLDELKRVVR
QRVARISEQIDTFRKMEDKRLAAVELENNQMRERIAKLEASRVVLHEQLVASTQKMLRDT
LTGLPNRLAFDERVALEAARMQREKTPLCLALWDVDYFKRVNDTFGHQAGDKALHVVGKT
LSQLIRDVDMVARYGGEEFVMVLPKADLQQAFVVLERIREKLAGTAFRFKDTPLKITLSC
GVAEFGAGETIESVMARADEALYRAKSNGRNRTEMSHSKR
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaacgactcggcaaaaacggattaccgcgccaaatacgaacagttgctggatgagttc
agttcgcttgaaaccagcgagcaactccagcagagtttgttgcgtagcctgcttaaccga
gttttgtttgcggtggataaagcgtatcccactctggccaaagagagtcaggcgctgcgc
gatctcatgcgccagatcggtgatggaccgctgcctgtggcccgcattcaaccgggaatc
gagcatctggccgaagccattcgagccatcgaagcaggtgatccgaccccggatcgcgaa
gaggcgttgagtaacgacgaagcggccgagcgtgtggacgttcgggattttcttccgctg
ttactggaacgggtggccttcaccgagtcgatggagggccgacgcgaaaagctcctggct
attttgaataatcccaaagacaagaccctgaattccatcttgatcgatcgtgcggccacg
ctaatcaacgacatgcgtcgcgcgctcgaaaatgaaaaaaacgagttgaccgagttcctg
cggcagctaacggaagccttgtccgaaatcgatcaacacacgctcgccaacctcggcgat
atcgagacgcaacgcaaggttcaggaagccttgggtaacgcggttaccgagcaggtgtcg
cacattgatcgtaccgtttccgatgcgaccgatctggatgaactaaagcgtgtcgttcgt
cagcgagtggcacggatcagcgagcagatcgatacgtttcgcaagatggaagataagcgt
cttgccgcggtcgagttggaaaacaaccagatgcgtgagcgcatcgctaagctcgaagca
tcgcgtgtggtgctgcacgagcaactggttgccagcacacagaaaatgttgcgtgatact
ctcaccggattgccgaatcgtttggccttcgatgagcgtgtagcgctcgaggcggcccgg
atgcagcgtgagaaaacacctttatgcctagcgctttgggatgtcgattatttcaagcgt
gttaacgataccttcggccaccaagcgggcgacaaggccttgcacgtcgttgggaagaca
ttgagtcagttgatccgcgatgtggacatggtcgcgcgctatggaggcgaggaatttgtg
atggtgctgccgaaagcagacttacagcaagcgttcgtcgtgctggagcgcattcgggaa
aagctggcgggcactgctttccgctttaaggacacgccgctgaaaatcaccttatcctgc
ggtgtcgccgagttcggtgcgggtgaaacgattgaaagcgtgatggcccgggccgatgag
gccctgtatcgagccaaatcaaatggccggaatcgtacagaaatgtcgcattctaagcgg
taa

DBGET integrated database retrieval system