KEGG   Halothiobacillus neapolitanus: Hneap_2246Help
Entry
Hneap_2246        CDS       T01104                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hna  Halothiobacillus neapolitanus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hna01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:hna00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2418177..2419328)
Genome map
AA seq 383 aa AA seqDB search
MNDAFHPDPTIALAQDLIRRASVTPEDAGCQPLLAERLAAMDFTITPLRFGAVDNLWAVR
GSSGPLFCFAGHTDVVPTGDATAWSQPPFAANIVDDVLIGRGSADMKGSIAAMVTAIERF
VQTTPEPPFRMAFLITSDEEGVAVDGTVKVIEWLNARDEKIDWCLVGEPSSRERLGDEYK
IGRRGSITGNLVVHGKQGHVAYPHLADNPVHRAAPFLAELTAIEWDQGNAHFPPSTLQIA
NIQAGTGANNVIPGALHVQFNLRFNTESSVEKIQARVEALLEKHQLRHTLNWSVSGQPFL
TKQGAFVQAVEAAVAQVTGVKPLPSTAGGTSDGRFIAPTGAEVVELGPLNATIHQIDERV
PVAHLIDLSRIYEALLNQLAATL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgcgttccatcccgacccgaccattgctctggcgcaagatctgattcgccgg
gcctcggtcacgccggaagatgccggttgtcagccgttattggctgaacgtcttgccgca
atggatttcacgatcacgccgctgcggtttggtgctgtggataacctctgggcggtgcgt
ggctcatccggcccgttgttttgttttgccggtcacaccgacgtggtgccgacgggcgat
gccacagcctggagccagccgccgtttgccgcgaacatcgtcgatgacgtgctgatcggc
cgcggcagcgcggatatgaaaggttcgatcgcggcgatggtcacggccatcgagcgtttt
gtgcagacgacgcccgaaccaccgtttcgcatggcttttttgattaccagcgatgaagaa
ggcgtggccgtcgatggcacggtcaaggtcatcgagtggttgaacgcgcgcgatgaaaaa
atcgactggtgtctggtgggcgaaccctccagtcgcgagcgcctgggcgatgaatacaag
attggtcgtcgcggctcgatcacgggcaatctcgttgtccacggcaagcaaggccatgtc
gcctatccgcatctggcggataatcccgtacaccgcgccgcgccgtttctggccgaactc
acggccatcgaatgggatcagggcaacgcgcattttccgccttcgaccctgcaaatcgcc
aatattcaggccggtacgggcgcgaacaacgtgattcccggtgcgttgcacgtgcaattc
aatctgcgcttcaacaccgaaagctcggtggaaaaaatccaggcacgcgtcgaagcctta
ctggaaaaacaccaactgcgacataccttgaattggtctgtttcagggcaacccttcctg
acgaaacagggcgcgttcgtgcaggcggtcgaggcagcggtggcgcaggtgacgggcgtc
aaaccgttgccgtctacggcgggcggcacctctgatggccgctttattgcaccgacaggg
gcagaggtggtggagctcggcccgctgaacgcgacgatccatcaaattgacgagcgagtg
ccggtggcgcaccttatcgatctgtcgcgcatttatgaggccctgcttaatcaactggca
gcgacgctttga

DBGET integrated database retrieval system