KEGG   Halothiobacillus neapolitanus: Hneap_2384Help
Entry
Hneap_2384        CDS       T01104                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
hna  Halothiobacillus neapolitanus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Hneap_2384
Enzymes [BR:hna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Hneap_2384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2551855..2552805)
Genome map
AA seq 316 aa AA seqDB search
MNHTFAYLSAGGFLGLPITPDAPSSSESGKPFAVAGVTWDCSVTNRPGSRLGPGAIRQAS
RMLCDATHPLFDTSPLDKLVDLGDLLLPNTSLESMRAALMPQVSALLDRHEMVWLGGDHS
ITLPLLRAYRAHFGQPLACIHFDAHCDTWTDHFGEPSGHGTWVYEAFKEGLVIPEAFVQV
GIRSSGVREAREFVNDQGGRIYTARELRGRDGAGLQDVIDEVRARLAQNGNPPVYLSFDI
DVFDPAFAPGTGTPEPGGLTTAQAMTLLEGWHDLNWVGMDLVEVAPPYDHAELTSNAAST
MIWTWLCGRLAACAST
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatacgtttgcctatttgtctgccggcgggttcctcgggttgccgattacgccg
gatgcgccgtcctcctccgagtcgggcaagccgtttgccgtggccggtgtgacctgggat
tgcagtgtcaccaatcgtcccggatcgcgtctcgggcctggtgcgattcgtcaggccagc
cggatgctgtgcgacgcaacccacccgctgttcgatacctcgccgctcgataaactggtc
gatctgggcgatttgctgcttcccaatacgagtcttgagagcatgcgtgccgctttgatg
ccgcaagtgagcgcactgctggatcggcatgaaatggtctggctcggcggcgatcattca
atcaccttgccgttgttgcgcgcctatcgtgcgcatttcggccaaccgctggcctgcatc
catttcgatgcccactgcgatacctggacggaccacttcggcgagccttccggtcatggc
acctgggtgtatgaagcctttaaagaagggctggtcataccggaagcctttgttcaggtc
ggcatccgttcatcgggcgtgcgcgaggcgcgtgaattcgtgaacgatcagggcggtcgc
atttatacggcccgtgaattgcgcgggcgcgatggtgccggtttgcaggatgtcatcgac
gaggtgcgggcacgtctggcgcagaacggaaatccgccggtctatctgtccttcgatatt
gatgtcttcgatccggccttcgcccccggaacgggcacgccggagccgggcggactgact
accgcgcaggccatgaccttgctggaaggttggcacgatctcaattgggtaggcatggat
cttgtcgaagtggccccgccgtacgatcacgccgagctgaccagcaatgcggcatcgacc
atgatctggacctggctctgtggtcgtctagccgcctgtgcctcaacttga

DBGET integrated database retrieval system