KEGG   Hyphomonas neptunium: HNE_0031Help
Entry
HNE_0031          CDS       T00397                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hne  Hyphomonas neptunium
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HNE_0031
   01230 Biosynthesis of amino acids
    HNE_0031
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HNE_0031
  Energy metabolism
   00680 Methane metabolism
    HNE_0031
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HNE_0031
Enzymes [BR:hne01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HNE_0031
Exosome [BR:hne04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HNE_0031
  Exosomal proteins of melanoma cells
   HNE_0031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(21486..22199)
Genome map
AA seq 237 aa AA seqDB search
MTKLALIRHGQSAWNLENRFTGWWDADLTAQGEAEARHSGKLLAEVDADFRAGFTSVQTR
AIRTMWLALTEMKRVWLPIEKDWHLNERHYGGLTGLNKAETAAKHGEDQVHVWRRSYDIP
PPPLEVGSTFDLSTDPRYRGIDIPNTESLKTTLDRVLPYWQQKIAPGLIAGTDTMIAAHG
NSLRALVKHLFNVPDETITGLEIPTGNPLLIELDPNLKPVSVRYLDAERAHSLPDLP
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagctcgccctgatccggcacggccagtcggcctggaatctggaaaaccgtttc
accggctggtgggacgctgacctgacagcccagggcgaagccgaagcgcgccattcgggc
aagctgctggcggaagtcgatgccgatttccgcgccggcttcaccagcgtgcaaacccgc
gccatccgcacaatgtggctggcactgaccgagatgaagcgcgtgtggctgccgatcgag
aaagactggcacctcaacgaacgtcactatggcggcctgacagggctcaacaaggcagag
accgctgccaagcatggcgaagatcaggtgcatgtctggcgccgcagctatgatattccg
cccccgccgctggaagtcggcagcacgttcgatctctcaaccgatccccggtatcgcggc
atcgacattccgaacacggaaagcctgaaaacgaccctcgaccgcgtattgccttactgg
cagcagaaaattgcgccggggctgatcgccgggaccgacacgatgatcgccgcgcacgga
aactccctgcgcgcgctggtcaaacacctgttcaatgtgccggacgaaacaatcaccggg
ctggaaattcctaccggaaatcccttgctgatcgagcttgatcccaatctcaagccggta
tcggttcgctatctcgacgcagagcgcgcccatagcctgcctgacctgccatga

DBGET integrated database retrieval system