KEGG   Hyphomonas neptunium: HNE_0098Help
Entry
HNE_0098          CDS       T00397                                 

Definition
alpha/beta fold family hydrolase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
hne  Hyphomonas neptunium
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hne00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
86433..87386
Genome map
AA seq 317 aa AA seqDB search
MAKSSDDRRSRFVEVPWNTPPKGAEIVWFEGSEGRRLRACIAPALSQSKPRGTVIVCPGR
TEFIEKYFEVGRELQQMGFALVILDWPGQGLSDRLLPDSKKGHIDRFETFMTALAKGLEA
FDSHLPRPYISLAHSMGGAIALAAIAKGLVKVEAAAFCAPMWGIKSPVLGMRYLVWAMRA
TGRSGDYAMQPGPPERFETNIVTHDKRRWDLQRALIDAQPDLELGPVTWGWLGASLDIFS
AFSKPKALASIDIPVFVASAGEEKLVDNASHAKIAARLKDCDHITVDGAMHEILMETDDR
RAEFWDGFQKLLKRAGI
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatcctccgatgacaggcggagccggtttgttgaggttccgtggaacacgccg
cccaaaggcgccgaaatcgtatggtttgaggggtctgaagggcgccgtctccgggcctgc
atcgcgccggcgctctctcagtccaagccgcggggcacagttatcgtctgtccggggcgc
acagagttcatcgaaaaatatttcgaagtgggccgtgagttgcagcaaatgggctttgcg
ctcgtgatcctggactggccgggccagggtctctcggaccgccttctgcctgacagcaag
aagggtcatatcgaccggttcgagaccttcatgacagccctcgccaaggggctggaggcg
ttcgacagccatttgccacgcccatatatttcgctggcccactcgatgggaggcgccatt
gcgctggctgctattgccaaaggtcttgtgaaggtggaggcggccgccttctgcgcgccg
atgtggggtattaaatcgccggtccttggcatgcgatacctcgtctgggccatgcgggcg
acagggcgctcaggcgactatgcgatgcagcccggcccgccggaacggtttgaaaccaat
atcgtgacccatgacaagcgccgctgggacttgcagcgcgccctcattgatgcccagccc
gatctggaactcggcccggtcacgtggggctggttgggcgcctctctggatattttctcg
gccttttcaaaaccgaaggcgctggcaagcatcgacattccggtctttgtggcatccgcc
ggagaagaaaagctcgtcgataatgcttcccatgccaaaatcgcggctcgtctgaaggat
tgcgatcacatcacggttgacggcgcgatgcacgaaatcctgatggagacagacgaccgg
cgcgccgagttctgggacggctttcaaaaattactcaaacgtgcgggcatctga

DBGET integrated database retrieval system