KEGG   Hyphomonas neptunium: HNE_0125Help
Entry
HNE_0125          CDS       T00397                                 

Gene name
bdhA
Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
hne  Hyphomonas neptunium
Pathway
hne00072  Synthesis and degradation of ketone bodies
hne00650  Butanoate metabolism
hne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    HNE_0125 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    HNE_0125 (bdhA)
Enzymes [BR:hne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     HNE_0125 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1776
Motif
Other DBs
NCBI-ProteinID: ABI76124
UniProt: Q0C5Y4
Position
complement(110804..111586)
Genome map
AA seq 260 aa AA seqDB search
MLAGKTALITGSTSGIGKAVALQLAADGANIVLNGFGDAKEIETLRAGIEKDHKVKAAFS
GADLTKPEAIEAMMTEAAGTFGGIDILVNNAGTQFVSPLEDFPVEKWNLIIALNLSAAFH
TTRLALPHMKAKKWGRIVNMGSAHAKVASPFKAAYVAAKHGLSGLTKTTALEGATHGVRC
NTICPGYVFTPLVEGQIADTAKARGMTEDQVKNDVLLAAQPTKEFVTAEEVAAFASFLCS
PAAAQINGADLSIDGGWTAQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctagccggaaaaaccgccctcatcactggctccaccagcggcatcggaaaggccgtc
gcgctacagctcgcagccgacggggccaacatcgtccttaacggtttcggtgacgcaaag
gagatagagacacttcgcgccggtattgaaaaggatcataaagtaaaagctgccttctcc
ggcgctgacctcacaaaacccgaggccatcgaagcgatgatgaccgaagccgcaggcacc
ttcggcggcatcgacatcctcgtaaacaatgccggcacccagttcgtctcccccctcgaa
gacttcccggtggagaagtggaacctcatcatcgcgctgaacctctcggccgccttccac
acgacgcgcctcgccctgccccacatgaaggcgaaaaaatggggccgcatcgtcaatatg
ggctcagcccacgccaaggtcgcctcccccttcaaggccgcctatgttgccgccaagcac
ggcctctccggcctcaccaagaccaccgccctggaaggcgccacgcatggcgttcgctgc
aacaccatatgccccggctatgtgttcacccccctcgttgaaggccagatcgccgatacc
gccaaggcccgcggcatgactgaagaccaggtgaagaatgacgttctcctcgccgcccag
ccgaccaaggaattcgtcaccgccgaggaagtcgccgccttcgccagcttcctctgctca
cctgccgccgcccagatcaacggcgcagacctctccatcgatggcggctggaccgcacag
taa

DBGET integrated database retrieval system