KEGG   Hyphomonas neptunium: HNE_0169Help
Entry
HNE_0169          CDS       T00397                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
hne  Hyphomonas neptunium
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:hne00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(156619..157407)
Genome map
AA seq 262 aa AA seqDB search
MAVTADILAAIALAAGKEIMRVYRTDFSVSHKDDHSVLTEADGLAEAIILKGLAEAEPSL
QVIAEEAVAGGHMPEHGARFALVDPLDGTKEFVAKNGEFTVNIAIIEHGRPVMGVVYVPA
QNRLFVAEGPGKAWHANAAPDGPVPGDRTTLKVRPAPAAGLTAVASKSHRSPETDEWLSQ
YPVAEIKGAGSALKFCLVAAGEADVYPRLGRTMEWDTAAGQAVVEAAGGRVLTISGEPLL
YGKRDRGYDNPHFVVFGDVTPH
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaccgcagacattctcgccgctatcgcccttgccgccggcaaggaaatcatg
cgcgtttatcgcacggacttcagcgtcagccacaaggacgatcattccgtactgaccgaa
gccgatggccttgccgaagcaatcatactgaaaggcctcgccgaggcggagcccagcctc
caggtcatcgccgaagaggcggtcgcgggcggacacatgcccgaacacggcgcccgcttc
gcactggttgacccgctggacgggaccaaggaattcgtcgcaaagaatggcgagttcacg
gtgaatattgcaatcatcgaacatggccgtccggtcatgggcgtcgtttatgttcctgcc
cagaaccgtctttttgtcgccgaaggccctggcaaagcctggcatgcaaatgctgcaccc
gacgggccggttcccggcgatcgcacgacgctcaaggtacgccctgccccggctgccgga
ctaaccgccgttgcctccaagtcgcaccgtagtcccgagacggatgaatggctgtcgcag
tatccggttgccgaaatcaaaggggctggctctgccctgaaattctgcctcgttgcagca
ggtgaggcagacgtctacccccgtctcggccgcaccatggagtgggatactgctgctgga
caggccgtcgtggaagctgccgggggccgcgtactgactatttccggagagcccctcctc
tatggcaagcgggaccgcggatacgacaatccccactttgtcgtttttggagatgtgacg
ccgcattga

DBGET integrated database retrieval system