KEGG   Hyphomonas neptunium: HNE_0313Help
Entry
HNE_0313          CDS       T00397                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hne  Hyphomonas neptunium
Pathway
hne00020  Citrate cycle (TCA cycle)
hne00310  Lysine degradation
hne01100  Metabolic pathways
hne01110  Biosynthesis of secondary metabolites
hne01120  Microbial metabolism in diverse environments
hne01130  Biosynthesis of antibiotics
hne01200  Carbon metabolism
Module
hne_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hne_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HNE_0313 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    HNE_0313 (sucB)
Enzymes [BR:hne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HNE_0313 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_D23 GCV_H HlyD_3 PYNP_C Peptidase_M23 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ABI77628
UniProt: Q0C5F0
Position
309362..310912
Genome map
AA seq 516 aa AA seqDB search
MTDIVVPTLGESVTEATVGQWLKSAGDAVKKDEVLVELETDKVSVEVSASEDGVLSEIVA
KEGDTVDIGALLGRLNANGAAKPAPAKEAPKAEAKAEPKAEPKAAEAKPAASSGGGASTD
VKVPVMGESVAEGTIANFAKKVGESVKKDETIAEIETDKVALEVPAPADGVILEWLVKEG
DSVTPGSVIARIGASGAAPAKAAEAPAKAEAPKAAAQPAATGDRPVSPSVRRISTEAGVS
ASDIPGTGRDGRATKADALAYVNQPKASASTMPDTAAKPPRETGPREERVRMTRLRQTIA
RRLKEAQDTAAMLTTFNDVDMSAIMDLRKQHQDAFVAKHGIKLGFMSFFVKACVNALKEV
PAVNAEIDGQDVIYKNYYDIGVAVGTEKGLVVPVVRDADDLSLAGIEKAIAALGKKARDG
DLTIGDMQGGTFTISNGGIYGSLMSTPILNPPQSGVLGMHRIEDKPIVRNGQIVIKPMMY
LALSYDHRIVDGKEAVTFLVRVKEALEDPERMLLEV
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgacagacattgttgttcccacactcggcgaaagcgttaccgaagccaccgtcggccaa
tggctgaaatcggccggcgacgcggtgaagaaggacgaagtcctcgtcgaacttgaaacc
gacaaggtttccgtcgaggtttcggcctctgaagacggcgtcctgtcggaaatcgtggcc
aaggaaggcgacactgtggacatcggcgcgctgctcggccgcctgaacgccaatggcgcg
gccaagcctgcacccgccaaggaagccccgaaggctgaagccaaggcagagccgaaagcg
gaacccaaagcggccgaagccaagccggcggcctcgtccggcggcggtgcgtccacggac
gtaaaagtccccgtgatgggcgaaagcgttgccgaaggcacgatcgccaacttcgccaag
aaggtcggcgagagcgtcaagaaagacgagaccatcgccgagatcgaaaccgacaaggtg
gcgctggaagttccagcccccgcagacggcgtgatcctcgaatggctggtcaaggaaggc
gattccgtgacccccggttccgtcattgcacggattggcgcctcgggcgcggcccctgca
aaagctgccgaagcgcccgcgaaagccgaagcgcccaaagccgccgcccagccagcagcc
accggcgatcgccccgtttccccatcggtccgccgcatttccaccgaagccggcgtcagc
gcgtctgatattcccggcaccggccgcgatggccgcgccaccaaggcggatgccttggcc
tacgtcaaccaaccgaaagcaagcgcctcgaccatgcccgacaccgccgcaaaaccaccg
cgcgaaaccggcccccgtgaagaacgtgtacggatgacgcgtctgcgtcagaccatcgcc
cgccgcctgaaggaagctcaggacacggccgcgatgctgaccacgttcaacgatgtcgac
atgtcggcgatcatggatctgcgcaagcagcaccaggacgccttcgtcgccaagcacggc
atcaagctcggcttcatgagcttcttcgtgaaggcgtgcgtcaacgcgctgaaggaagtt
cctgccgtcaacgccgagatcgatggccaggacgtcatctacaagaactattatgacatc
ggcgtggccgtcggcaccgagaagggccttgttgtgcccgtcgtgcgcgacgcagacgat
ctctcgctggccggcatcgagaaagccatcgcggcgctgggcaagaaagcccgtgacggc
gatctcaccatcggcgacatgcagggcggcaccttcaccatctcgaacggcggcatctat
ggctcgctgatgtcgaccccgatcctcaatccgccgcagtccggcgtgctcggtatgcac
cgtatagaggacaagccgatcgtccgtaacggccagatcgtcatcaagccgatgatgtat
cttgcgctgagctatgaccaccgcatcgttgacggcaaggaagcggttaccttcctcgtt
cgtgtcaaggaagcgctggaagatcctgagcggatgctgctcgaagtctaa

DBGET integrated database retrieval system