KEGG   Hyphomonas neptunium: HNE_0658Help
Entry
HNE_0658          CDS       T00397                                 

Definition
cytochrome c family protein
Orthology
K08738  
cytochrome c
Organism
hne  Hyphomonas neptunium
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:hne00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:hne02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(659971..660768)
Genome map
AA seq 265 aa AA seqDB search
MGELGLNKIIGAVLASALGIMFLMQLPNVVFASGAGHHGEEAEATTLSEKMCQQFHYCVE
VAEAAGAGADAAEEVFDLGAALASADLTRGERLFASQCSTCHTINAGGANGTGPNLHNTV
GADKAHIAGFAYSGALSNAEGSWTYENLNEWINNPSAYVRGTSMSFAGIRRDTDRAAVIA
YLAANTENAPAFPEPLPAAEEAGDEAVPAEGEAVEGEAAPADGAAVPAEGEAAPAAAEEG
AAPAEEAPATEEAPTEAPAEEAPAE
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgggagagctcggtctcaacaagatcatcggagcggtgctcgcaagcgcgctcggcatc
atgttcctcatgcagcttccgaacgtggtgttcgccagcggcgcaggccatcacggcgag
gaagccgaggccacaacgctttcggaaaagatgtgccagcagttccactattgcgttgaa
gtcgctgaagcggcgggcgcaggcgcggatgcagcagaagaggtgtttgaccttggcgct
gcccttgccagcgcggacctgacccgcggtgaacgcctgttcgcgagccagtgctcgacc
tgccacaccatcaatgctggcggcgcaaacggcaccggcccgaacctgcacaacactgtg
ggcgccgacaaagcccatatcgccggatttgcttattccggcgcgctttccaacgcagaa
ggcagctggacctacgagaacctgaatgagtggatcaacaatccgagcgcttatgttcgg
ggtacgtcgatgtcgtttgcgggtattcgccgcgatacggaccgggcggcggtgatcgct
tatctggcggccaataccgagaacgcaccggcattcccggagccgctgccagctgctgaa
gaggccggtgacgaggctgttccagctgaaggtgaagcggttgaaggcgaggcggcacct
gctgacggcgctgcagttccagccgaaggcgaagcggccccggcggcggctgaagagggc
gctgctccggcagaggaagcccccgccaccgaggaggcgcctaccgaagcgcccgctgaa
gaagcccctgccgagtaa

DBGET integrated database retrieval system