KEGG   Hyphomonas neptunium: HNE_0672Help
Entry
HNE_0672          CDS       T00397                                 

Definition
(GenBank) Enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase/3-hydroxybutyryl-CoA epimerase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
hne  Hyphomonas neptunium
Pathway
hne00071  Fatty acid degradation
hne00280  Valine, leucine and isoleucine degradation
hne00281  Geraniol degradation
hne00310  Lysine degradation
hne00362  Benzoate degradation
hne00380  Tryptophan metabolism
hne00410  beta-Alanine metabolism
hne00640  Propanoate metabolism
hne00650  Butanoate metabolism
hne00903  Limonene and pinene degradation
hne00930  Caprolactam degradation
hne01040  Biosynthesis of unsaturated fatty acids
hne01100  Metabolic pathways
hne01110  Biosynthesis of secondary metabolites
hne01120  Microbial metabolism in diverse environments
hne01130  Biosynthesis of antibiotics
hne01200  Carbon metabolism
hne01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    HNE_0672
   00650 Butanoate metabolism
    HNE_0672
  Lipid metabolism
   00071 Fatty acid degradation
    HNE_0672
   01040 Biosynthesis of unsaturated fatty acids
    HNE_0672
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HNE_0672
   00310 Lysine degradation
    HNE_0672
   00380 Tryptophan metabolism
    HNE_0672
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HNE_0672
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HNE_0672
   00281 Geraniol degradation
    HNE_0672
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HNE_0672
   00930 Caprolactam degradation
    HNE_0672
Enzymes [BR:hne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     HNE_0672
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     HNE_0672
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     HNE_0672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DAO UDPG_MGDP_dh_N 2-Hacid_dh_C F420_oxidored FAD_binding_3 GIDA Sacchrp_dh_NADP NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABI75436
UniProt: Q0C4E2
Position
676970..679201
Genome map
AA seq 743 aa AA seqDB search
MKLETFKFDIDADGIAHAIFDVPGRSMNTLTGKAVQDIIAITQEVASNEKITGLVISSGK
ESGFCAGADLGEMGNRAGAGGEQKKKSEDELKKEQFEAGFALNGTLRKLETCGKPVAVAL
NGLALGGGLEVALACHYRVAANDNPRIQFGLPEAKIGLLPGAGGTQRLPRLVGVQAALPL
ILQGESFNAEKAHSMGVVQELAPGAETVARAKAWVKANPKAKAPWDEKGYKVPGGVPHKS
PGAGQVATMANMMLASKTYGNYPAQKNILSCIYEGIQVPIDAGLRIETRYFINTQQRPEA
KAMIRSLFLSTQALSKGANRPSGFEKAELKKVGIIGAGLMGAGIAYEQARAGIRTVLVDV
KQEAAEKGKQYAVRLVEKDISRGKSTKEKGDALLSLITPTTDYKLLEDCDLIVEAVYEDI
DLKHKVLADAEAALGENAIVGSNTSTLPITQLSTPLKRKDKFIGIHFFSPVERMGLVEII
MGKETSQETLAKTIDYVLKIRKTPIVVNDSRGFYTSRCFGTYTQEGLEMLSEGIKPAIIE
NVGRQAGMPMGPLEVSDSVGLDTALKVGRATAKAVGFDYNEAPLGRMMAWIVEDKGRVGR
KAGKGFYDYNDQGKPDRIWPDLNEQVEVKIDECPPALKKELTNRLLIRQAIEVSRCFEEG
VIQDARDGDIGSILAWGFAPYTGGCVSYMDLIWGVPAFVAEADRLAEKYGERFRPGKLLR
EMAEKGQSFYERFPPAGEKKAAA
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgaaacattcaaattcgacatcgatgccgatggcatcgcccacgctatcttc
gacgtgcctggccgcagcatgaacaccctgaccggcaaagccgttcaggacatcatcgca
atcacccaggaagtcgccagcaacgaaaagatcacaggcctggtcatctcatccggcaag
gaaagcggcttctgtgcaggcgcagacctcggcgaaatgggcaaccgcgccggcgccggt
ggtgagcagaagaaaaagtccgaagacgaactgaaaaaagaacagttcgaagccggcttt
gccctcaacggcacgctccgcaaactcgaaacctgcggcaagcctgtagccgtcgcgctc
aatggcctcgcccttggcggtggcctcgaagtggcgcttgcctgtcattaccgcgtcgcg
gccaatgacaatccgcgcatccagttcggcctgccggaagccaagatcggccttctgccg
ggcgccggcggcacgcagcgtctgccccgcctcgttggcgttcaggccgcgcttccgctg
atcctgcagggcgaaagcttcaatgccgagaaggcccattccatgggcgtcgttcaggag
cttgctccgggcgcagaaacggtcgcccgcgccaaagcctgggtgaaagcgaaccccaaa
gccaaagccccttgggacgaaaaaggctacaaggtccccggcggcgttccgcacaaatcc
ccaggcgcgggtcaggttgcgaccatggccaacatgatgctggcctcgaaaacctacggc
aactatccggcccagaagaacatcctctcctgcatctatgaaggcatccaggtgcccatc
gatgcgggcctgcgtatcgaaacgcgctacttcatcaatacccagcagcgcccggaagcc
aaggcgatgatccgttcgctgttcctctccacccaggccctgtcgaaaggtgcaaaccgt
ccttcaggcttcgagaaggcagagctgaagaaagtcggcattatcggcgcaggcctgatg
ggcgccggcattgcgtatgagcaggcccgcgccggcatccgcactgtcctcgtggacgtg
aagcaggaagccgccgaaaagggtaagcaatacgccgtccgcctcgtcgaaaaagacatc
tcgcgcggcaagagcacgaaagagaagggcgacgcgctcctctccctcatcacgccgacc
acggactataagcttctggaagactgcgacctcatcgtcgaagccgtctatgaagacatc
gacctgaagcacaaagtgctggccgatgccgaagccgccctcggcgaaaacgccatcgtc
ggctccaacacgtcgaccctgccgatcacgcagctgtccacaccgctgaagcgcaaggac
aagttcatcggcatccacttcttctcgccggtcgagcggatgggtcttgtcgagatcatc
atgggcaaggaaaccagccaggaaaccctcgccaagacgatcgactatgtcctgaaaatc
cggaagacgccgattgtggtgaacgacagccgcggcttctatacttcccgctgctttggc
acctatacccaggaaggcctcgaaatgctgtccgaaggcatcaagccggccatcatcgaa
aacgtcggccgtcaggccggcatgccgatgggcccgctggaagtctccgactccgttggt
ctcgacacggctctcaaggttggccgtgcaacggcgaaggctgttggcttcgattacaac
gaagctccgctcggccgcatgatggcgtggatcgtggaagacaagggccgcgtcggccgc
aaggccggcaagggcttctacgactataacgatcagggcaagcccgaccggatctggccg
gacctcaatgagcaggtcgaagtcaagatcgacgagtgcccacccgccctcaagaaagag
ctgaccaaccgtctcctgatccgtcaggcgatcgaggtctcccgctgctttgaggaaggt
gtgatccaggacgcgcgcgatggcgacatcggttccatcctcgcctggggctttgcgccc
tataccggcggctgcgtcagctacatggatctcatctggggcgtgcccgcctttgtcgcc
gaggcagaccgccttgccgaaaagtacggcgagcgtttccgccccggtaaactcctgcgt
gaaatggcggagaagggccagtccttctacgaacgcttcccgccagcaggtgagaagaaa
gccgctgcctag

DBGET integrated database retrieval system