KEGG   Hyphomonas neptunium: HNE_0676Help
Entry
HNE_0676          CDS       T00397                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hne  Hyphomonas neptunium
Pathway
hne00900  Terpenoid backbone biosynthesis
hne01100  Metabolic pathways
hne01110  Biosynthesis of secondary metabolites
hne01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HNE_0676 (ispE)
Enzymes [BR:hne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HNE_0676 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABI76728
UniProt: Q0C4D8
Position
685501..686397
Genome map
AA seq 298 aa AA seqDB search
MSTADKSLSGWAPAKVNLYLHVGPPKPNGRHDLESLVMFSGSGAADHLTAEPAEGLSLSV
AGPFAAAAGAGDDNLVLQAARALQAASGTQQGARLSLKKWLPVAAGIGGGSSDAATALRL
LTKLWALDPNHAIALAPGLGGDVPVALAGQPSLMRGEGERVTPLPALPPVYAVLVNPGVP
CPTGPVFRDHDAAGGGAGFAEIDPPPEFSGPKAFAAWLGQQRNDLESPAIARVPEIGAVL
EFLRAQPGVLLARMSGSGATCFALCEALAFAERATAVIAHDAHKAHWWTAASRLGAAP
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcagacaaaagcctttcgggctgggcgcctgccaaggtgaacctctatctg
catgtcggcccgccaaaacccaatggccgccatgaccttgagtctcttgtaatgttctcg
ggttctggtgcggcagaccatctgacggcagagcctgccgaagggctcagcctttcggtt
gccggccccttcgccgctgcggccggggcgggcgatgacaatctggtccttcaggcggcc
cgcgcgctacaggccgcctccggcacgcaacaaggcgcccgtctttcgctcaagaaatgg
ctgcccgtcgccgccggcatcggcggtggctcctccgacgccgccacagccctccgtctg
ctgacaaaactctgggcgcttgacccaaaccatgccatcgcccttgcgccgggccttgga
ggggatgtgccggtagcgttggcggggcagccatcactcatgcgcggggaaggggagcgc
gtcacgccgctgcccgcgctgccgcccgtttatgccgtgctggtcaatcccggcgtccca
tgccccacaggcccggtcttccgcgaccatgacgcggcagggggcggcgcgggctttgcc
gagattgatccgccaccggagttttcagggcccaaagcattcgccgcctggctcggccag
caacgcaacgatctggaaagccctgccatcgcgcgcgtgccggaaatcggcgccgtgctc
gaattcctgcgcgcccagcccggcgtattgctggcgcgcatgagcgggtcaggtgccacc
tgttttgccctctgtgaagcgctcgcctttgcggagcgcgcaaccgccgtcatcgcccat
gatgcgcacaaggcgcattggtggaccgctgcctcccggctcggggcggcgccatga

DBGET integrated database retrieval system