KEGG   Hyphomonas neptunium: HNE_0769Help
Entry
HNE_0769          CDS       T00397                                 

Definition
(GenBank) putative diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
hne  Hyphomonas neptunium
Brite
Enzymes [BR:hne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     HNE_0769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(778903..779886)
Genome map
AA seq 327 aa AA seqDB search
MFQLSEKYKTAPFPNAYAVWFAYSTNADPALVAEIDELLLGQDAISAYDIELLFQAYLAE
EQSVFATHDISQAIGDEIDEVLSVLGTSLQQNTAFSETLSTLEQDLPQASSPEQFNTLVS
GLIEENRRMNAMTQELNQGLARSQSLISTLSEQLDEVRTQSLRDPLTAIPNRRAFDKTLE
EAMDHAARTHEPLCVAMADLDHFKALNDTFGHPAGDVVLQNFARLISGSANEPRLVARYG
GEEFAIIFPGSDLMAAYNRLVNIKHTLSKTVHEAEGSVGPLPAVTASFGVAKYQPGMTAR
ELIQKADASLYDAKAKGRNRVCAPGIG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgttccagctcagcgagaagtacaagaccgcgcccttccccaatgcctatgccgtgtgg
tttgcctattccaccaatgccgatccggcgctggtggcggagattgatgagctgctgctg
gggcaggacgcgatttcggcctatgacattgagctgctgttccaggcctatctggccgaa
gaacagagcgtgtttgccacccatgacatcagccaggcgattggcgacgagattgacgaa
gtgctctcggtgctcggcacgagcctgcaacagaacaccgccttttcagaaacactgtcg
acgctggagcaggacctgcctcaagcctcttcgccggagcagttcaacacgctggtttcc
ggactgatcgaggaaaaccggcgcatgaatgcgatgacgcaggagctgaaccagggcctg
gcccggtcgcagagcctgatctccactttaagcgaacagctggacgaagtgcgcacgcag
agcctgcgcgatccgctgaccgccattcccaaccgccgcgcctttgacaagacgctggaa
gaggcgatggaccatgccgcgcgcacgcatgaaccgctatgcgtggcgatggcggacctc
gaccatttcaaggcgctcaacgatacctttggccaccctgccggcgatgttgtgttgcag
aattttgcgcggctgatttccggcagcgccaacgagcccaggcttgtggcgcggtatggc
ggcgaggagtttgcgatcatcttccccggcagcgacctgatggcggcctataaccggctg
gtgaacatcaagcatacgctcagcaagaccgtgcatgaagccgaaggcagcgtcgggccc
ctgcccgccgtgaccgcctcgttcggtgtggcgaaatatcagccgggcatgaccgcgcgc
gagctgatccagaaggccgacgccagcctctatgatgccaaggccaagggccgcaaccgc
gtctgcgcgccggggattggctga

DBGET integrated database retrieval system