KEGG   Hyphomonas neptunium: HNE_0769Help
Entry
HNE_0769          CDS       T00397                                 

Definition
putative diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
hne  Hyphomonas neptunium
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(778903..779886)
Genome map
AA seq 327 aa AA seqDB search
MFQLSEKYKTAPFPNAYAVWFAYSTNADPALVAEIDELLLGQDAISAYDIELLFQAYLAE
EQSVFATHDISQAIGDEIDEVLSVLGTSLQQNTAFSETLSTLEQDLPQASSPEQFNTLVS
GLIEENRRMNAMTQELNQGLARSQSLISTLSEQLDEVRTQSLRDPLTAIPNRRAFDKTLE
EAMDHAARTHEPLCVAMADLDHFKALNDTFGHPAGDVVLQNFARLISGSANEPRLVARYG
GEEFAIIFPGSDLMAAYNRLVNIKHTLSKTVHEAEGSVGPLPAVTASFGVAKYQPGMTAR
ELIQKADASLYDAKAKGRNRVCAPGIG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgttccagctcagcgagaagtacaagaccgcgcccttccccaatgcctatgccgtgtgg
tttgcctattccaccaatgccgatccggcgctggtggcggagattgatgagctgctgctg
gggcaggacgcgatttcggcctatgacattgagctgctgttccaggcctatctggccgaa
gaacagagcgtgtttgccacccatgacatcagccaggcgattggcgacgagattgacgaa
gtgctctcggtgctcggcacgagcctgcaacagaacaccgccttttcagaaacactgtcg
acgctggagcaggacctgcctcaagcctcttcgccggagcagttcaacacgctggtttcc
ggactgatcgaggaaaaccggcgcatgaatgcgatgacgcaggagctgaaccagggcctg
gcccggtcgcagagcctgatctccactttaagcgaacagctggacgaagtgcgcacgcag
agcctgcgcgatccgctgaccgccattcccaaccgccgcgcctttgacaagacgctggaa
gaggcgatggaccatgccgcgcgcacgcatgaaccgctatgcgtggcgatggcggacctc
gaccatttcaaggcgctcaacgatacctttggccaccctgccggcgatgttgtgttgcag
aattttgcgcggctgatttccggcagcgccaacgagcccaggcttgtggcgcggtatggc
ggcgaggagtttgcgatcatcttccccggcagcgacctgatggcggcctataaccggctg
gtgaacatcaagcatacgctcagcaagaccgtgcatgaagccgaaggcagcgtcgggccc
ctgcccgccgtgaccgcctcgttcggtgtggcgaaatatcagccgggcatgaccgcgcgc
gagctgatccagaaggccgacgccagcctctatgatgccaaggccaagggccgcaaccgc
gtctgcgcgccggggattggctga

DBGET integrated database retrieval system