KEGG   Hyphomonas neptunium: HNE_0959Help
Entry
HNE_0959          CDS       T00397                                 

Gene name
bktB
Definition
(GenBank) beta-ketothiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hne  Hyphomonas neptunium
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HNE_0959 (bktB)
   00630 Glyoxylate and dicarboxylate metabolism
    HNE_0959 (bktB)
   00640 Propanoate metabolism
    HNE_0959 (bktB)
   00650 Butanoate metabolism
    HNE_0959 (bktB)
  Lipid metabolism
   00071 Fatty acid degradation
    HNE_0959 (bktB)
   00072 Synthesis and degradation of ketone bodies
    HNE_0959 (bktB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HNE_0959 (bktB)
   00310 Lysine degradation
    HNE_0959 (bktB)
   00380 Tryptophan metabolism
    HNE_0959 (bktB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HNE_0959 (bktB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HNE_0959 (bktB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HNE_0959 (bktB)
Enzymes [BR:hne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HNE_0959 (bktB)
Exosome [BR:hne04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HNE_0959 (bktB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
973446..974657
Genome map
AA seq 403 aa AA seqDB search
MRDVVIVEPVRTAVGGFGGAFKGVHAHELGAAVVEGLMARTGLAKDKVDDVIFAQCYPSM
DAPALGRVVALDAGLPVEVTGMQIDRRCGSGLQAIINATMQVATGAMDCVIAGGAESMSN
APFYSTNWRWGLGQGNMTVHDGLVNGRLTAGGKNFPVPGGMLETAENLRRDYQITRQAQD
EFAAASHAKAVAAQNSGVFDEEIIPFTVKGRKGDTVVTKDEHPRPDSTLEVLSKLKPIRQ
KQDAEATVTAGNASGQNDGGSACLVMTREMAEANGLKPLARLVSWSVAGVGPAVMGIGPV
PSTEKALARAGLTLKDIDLIELNEAFAAQVLACTKAMGFAKEDYARLNVHGSGISLGHPV
GATGGRILATLLREMDRREARYGVETMCIGGGQGLAAVFERVN
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgacgttgtgattgtggagccggtgcggacggcggtgggtggctttggcggcgcg
ttcaagggcgtgcacgcgcatgagctgggcgcggcggtggtcgaagggctgatggcgcgc
acgggcctggcgaaagacaaggtcgatgatgtgatcttcgcccagtgctacccttcgatg
gacgcgcccgcgctgggccgggttgtggcgctcgatgccgggctcccggtagaagtcacc
ggcatgcagatcgaccggcgctgcggctctggccttcaggcgatcattaacgccacgatg
caggtggccaccggcgcgatggactgcgtgatcgccggcggcgccgagtcgatgagcaat
gcgccgttctattccaccaactggcgctggggtctcggtcagggcaacatgacggtgcat
gatggcctcgtgaatggccgtctgacagcgggtggcaagaacttccccgtacccggcggc
atgctggagacggccgaaaaccttcgccgcgattaccagatcacccgccaggcgcaggac
gaattcgccgccgcttctcatgccaaggcggttgccgcgcagaactccggcgtgttcgat
gaggaaatcattccgttcacggtcaagggccgcaagggcgataccgtagtgacgaaggac
gaacacccccgtccggactcaacccttgaagtgctctccaaactgaaacccatccgccag
aaacaggacgctgaagccaccgtcaccgccggcaatgccagcggccagaatgatggcggc
tcggcttgtctcgtgatgacgcgcgaaatggcagaggccaatggcctcaagccgctcgcc
cggctggtctcctggtcggtggccggggttggcccggcggtgatgggcatcggccctgtt
ccgtccacggaaaaggcgctggcgcgcgcgggcctgacgctgaaagacattgacctgatc
gaactcaacgaagcgtttgccgcgcaggtgcttgcctgcaccaaggcgatgggcttcgcc
aaggaagactatgcgcgcctcaatgtgcacggatcgggcatttcactgggccatccggtc
ggcgcgaccggcgggcgtattctggccacgctgctgcgtgaaatggaccgccgcgaggcg
cggtacggcgttgaaaccatgtgcattggcggcgggcagggcctggctgcggtgttcgag
cgcgttaactga

DBGET integrated database retrieval system