KEGG   Hyphomonas neptunium: HNE_1045Help
Entry
HNE_1045          CDS       T00397                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hne  Hyphomonas neptunium
Pathway
hne00260  Glycine, serine and threonine metabolism
hne00750  Vitamin B6 metabolism
hne01100  Metabolic pathways
hne01110  Biosynthesis of secondary metabolites
hne01120  Microbial metabolism in diverse environments
hne01230  Biosynthesis of amino acids
Module
hne_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HNE_1045 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HNE_1045 (thrC)
Enzymes [BR:hne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HNE_1045 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ABI77964
UniProt: Q0C3C6
Position
1053709..1055091
Genome map
AA seq 460 aa AA seqDB search
MKYISTRGQAEPVDFAGACLAGLATDGGLYVPESWPQIAPATPGEPYAETAARILSAFAG
DAIPTDVMRRLCTQAYDRFAHRSVAPLTQAGPGLWLMELHHGPTLAFKDVAMQIIGQIYD
YLLGLSGQRMTVTCATSGDTGGAAAGAFAGAENVRLVILHPHERVSPVQRLFMTTTGAEN
VLNISVDGDFDDCQSMVKSMFADKAFSASVGLSGVNSINWARIAAQSVYYATASAQLGHR
PLRFVVPSGNMGDALAGYVAARCGLLPGGLEIHCAVNENDTLARVFNTGKMTRQAAVATP
SPAMDISVPSNFERLLFEVTGRDADAVRRTYETYAQQGEVDIPEAARARLSCTGLSAASV
GNADTLAEMERFRQETGWLICPHTAVGTQIARRLKPSDAVATIVLATAAATKFPETVKEA
TGEDAPLPSRCAELVDRGEVFERFASDPAAVRARIAAFAG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtatatttcgaccagaggtcaggcggaacctgttgattttgcaggcgcttgcctg
gcgggccttgccacggacggcggcctctacgtgcccgagagctggccgcagattgccccc
gccacgccgggtgaaccctacgccgagaccgccgcgcgcatcctctccgcctttgccggc
gacgcgattcccaccgacgtgatgcgccgcctctgcacgcaggcctatgaccgctttgcc
caccgctcggttgccccgctgacgcaggccgggccgggtctctggctgatggagctgcac
cacgggccaacgctcgccttcaaggatgtggcgatgcagatcatcggccagatctatgac
tatctcctcggcctttccggccagcggatgaccgtaacctgcgccacgtccggcgatacc
ggcggggccgccgccggcgcgtttgcgggcgcggagaatgtgcgcctcgtgatcctgcat
ccgcatgagcgggtctcgccggtccagcgcctgttcatgaccaccaccggggctgagaac
gtcctcaatatctcggtcgatggggattttgacgactgccagtcgatggtcaaatcgatg
ttcgcggacaaggcattctcagccagtgttggcctctcaggtgtcaactcgatcaactgg
gcgcgcattgctgcccagtccgtctactacgccaccgccagcgcccagctgggccaccgc
ccgctgcgctttgtggtgcccagcggcaatatgggcgacgcgctggcaggctatgttgcc
gcccgctgcggcctccttccgggtggcctcgaaatccactgcgcggtgaacgagaacgac
acgctggcccgcgtgttcaacaccggcaagatgacccgccaggcggctgtggccacgccc
agcccggcgatggacatctccgtgccgtctaatttcgagcgcctgctgtttgaagtgacc
ggccgggacgccgacgcggtgcgccgcacttacgagacctatgcccagcagggcgaggtg
gacattcccgaggcggccagggcgcgcctctcctgcacggggctgtcggcggcgtcggtg
ggcaatgccgataccctcgccgagatggagcgtttccggcaggagaccggctggctgatc
tgtccgcacacggcggtgggcacgcagattgcgcgccgcctgaagccgtctgacgctgtc
gccacaatcgttctggccacggcagctgccacgaaattccctgagacggtcaaggaagcg
accggggaggatgcgccgctgcccagccgctgcgccgagctggttgatcgcggggaggtg
ttcgagcggtttgcttccgatccggcagccgtccgcgcccgaatcgccgccttcgctggc
tag

DBGET integrated database retrieval system