KEGG   Hyphomonas neptunium: HNE_1045Help
Entry
HNE_1045          CDS       T00397                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hne  Hyphomonas neptunium
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HNE_1045 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HNE_1045 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HNE_1045 (thrC)
Enzymes [BR:hne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HNE_1045 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1053709..1055091
Genome map
AA seq 460 aa AA seqDB search
MKYISTRGQAEPVDFAGACLAGLATDGGLYVPESWPQIAPATPGEPYAETAARILSAFAG
DAIPTDVMRRLCTQAYDRFAHRSVAPLTQAGPGLWLMELHHGPTLAFKDVAMQIIGQIYD
YLLGLSGQRMTVTCATSGDTGGAAAGAFAGAENVRLVILHPHERVSPVQRLFMTTTGAEN
VLNISVDGDFDDCQSMVKSMFADKAFSASVGLSGVNSINWARIAAQSVYYATASAQLGHR
PLRFVVPSGNMGDALAGYVAARCGLLPGGLEIHCAVNENDTLARVFNTGKMTRQAAVATP
SPAMDISVPSNFERLLFEVTGRDADAVRRTYETYAQQGEVDIPEAARARLSCTGLSAASV
GNADTLAEMERFRQETGWLICPHTAVGTQIARRLKPSDAVATIVLATAAATKFPETVKEA
TGEDAPLPSRCAELVDRGEVFERFASDPAAVRARIAAFAG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtatatttcgaccagaggtcaggcggaacctgttgattttgcaggcgcttgcctg
gcgggccttgccacggacggcggcctctacgtgcccgagagctggccgcagattgccccc
gccacgccgggtgaaccctacgccgagaccgccgcgcgcatcctctccgcctttgccggc
gacgcgattcccaccgacgtgatgcgccgcctctgcacgcaggcctatgaccgctttgcc
caccgctcggttgccccgctgacgcaggccgggccgggtctctggctgatggagctgcac
cacgggccaacgctcgccttcaaggatgtggcgatgcagatcatcggccagatctatgac
tatctcctcggcctttccggccagcggatgaccgtaacctgcgccacgtccggcgatacc
ggcggggccgccgccggcgcgtttgcgggcgcggagaatgtgcgcctcgtgatcctgcat
ccgcatgagcgggtctcgccggtccagcgcctgttcatgaccaccaccggggctgagaac
gtcctcaatatctcggtcgatggggattttgacgactgccagtcgatggtcaaatcgatg
ttcgcggacaaggcattctcagccagtgttggcctctcaggtgtcaactcgatcaactgg
gcgcgcattgctgcccagtccgtctactacgccaccgccagcgcccagctgggccaccgc
ccgctgcgctttgtggtgcccagcggcaatatgggcgacgcgctggcaggctatgttgcc
gcccgctgcggcctccttccgggtggcctcgaaatccactgcgcggtgaacgagaacgac
acgctggcccgcgtgttcaacaccggcaagatgacccgccaggcggctgtggccacgccc
agcccggcgatggacatctccgtgccgtctaatttcgagcgcctgctgtttgaagtgacc
ggccgggacgccgacgcggtgcgccgcacttacgagacctatgcccagcagggcgaggtg
gacattcccgaggcggccagggcgcgcctctcctgcacggggctgtcggcggcgtcggtg
ggcaatgccgataccctcgccgagatggagcgtttccggcaggagaccggctggctgatc
tgtccgcacacggcggtgggcacgcagattgcgcgccgcctgaagccgtctgacgctgtc
gccacaatcgttctggccacggcagctgccacgaaattccctgagacggtcaaggaagcg
accggggaggatgcgccgctgcccagccgctgcgccgagctggttgatcgcggggaggtg
ttcgagcggtttgcttccgatccggcagccgtccgcgcccgaatcgccgccttcgctggc
tag

DBGET integrated database retrieval system